TkA06G030990 | RubberDandelionOmics

Gene overview

TkA06G030990

Reference: TK1151 Chr: Chr06 Coordinates: 8436040-8436501 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

462 bp · TkA06G030990|TK1151|cDNA

ACGCGGGATGCTTCCGGAATTTTTCGCGAAAAGATCGCGGTACGGTACACCCCGATCGGGATATTATTCTCCGCATCCGGCGTGATTCTCCTCTCATGGTTAAGTTTTCAGGAAATTGTGGCGGCGGAGAATTTTTTGTATTGTTTTGGGATGATTTTGGAGTTTATTGCTTTTGTGAGGCTGAGGATGAAGTATCCGGCGGCTTCTAGGCCGTACAAGATTCCGGTGGGGACCATTGGGTCGGTGCTTTTGTGTGTGCC...

CDS

Download CDS FASTA

462 bp · TkA06G030990|TK1151|CDS

ACGCGGGATGCTTCCGGAATTTTTCGCGAAAAGATCGCGGTACGGTACACCCCGATCGGGATATTATTCTCCGCATCCGGCGTGATTCTCCTCTCATGGTTAAGTTTTCAGGAAATTGTGGCGGCGGAGAATTTTTTGTATTGTTTTGGGATGATTTTGGAGTTTATTGCTTTTGTGAGGCTGAGGATGAAGTATCCGGCGGCTTCTAGGCCGTACAAGATTCCGGTGGGGACCATTGGGTCGGTGCTTTTGTGTGTGCC...

Protein

Download Protein FASTA

153 aa · TkA06G030990|TK1151|PROTEIN

TRDASGIFREKIAVRYTPIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVRLRMKYPAASRPYKIPVGTIGSVLLCVPPTILICVVLALSSIKVMVVSLVAIVIGLGLQPFLKYVERKRWVKFSTSADLPDLFNAHENSESLVY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G030990`
TK1151 ID	TkA06G030990
OH-1004 ID	LXL04_026031
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 88.235 / OH-1004 22.959 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G030990

Location Chr06:8436040-8436501 (+)

Description Similar to At1g31830: Probable polyamine transporter At1g31830

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g31830`	Probable cell membrane polyamine/proton symporter involved in the polyamine uptake in cells.	No verified direct reference in this release
`At5g05630`	Cell membrane polyamine/proton symporter involved in the polyamine uptake in cells.	Natural variation in a polyamine transporter determines paraquat tolerance in Arabidopsis.2012 · DOI: 10.1073/pnas.1121406109
`At1g31820`	Probable cell membrane polyamine/proton symporter involved in the polyamine uptake in cells.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2X8M8`	Cell membrane polyamine/proton symporter involved in the polyamine uptake in cells.	No verified direct reference in this release
`Os02g0700500`	Cell membrane polyamine/proton symporter involved in the polyamine uptake in cells.	Functional analysis of OsPUT1, a rice polyamine uptake transporter.2012 · DOI: 10.1007/s00425-011-1486-9

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026031 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009408 response to heat Biological Process

GO:0015839 cadaverine transport Biological Process

GO:0015846 polyamine transport Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0015203 polyamine transmembrane transporter activity Molecular Function

GO:0015293 symporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G31820

ath:AT1G31830

ath:AT5G05630

dosa:Os02g0700500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.303

Rank 1 · TkA06G030990 · TK1151

Lysosome / Vacuole0.225

Rank 2 · TkA06G030990 · TK1151

Golgi apparatus0.217

Rank 3 · TkA06G030990 · TK1151

Cell membrane0.162

Rank 4 · TkA06G030990 · TK1151

Cytoplasm0.118

Rank 5 · TkA06G030990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24432DUF755525-68 aa

PF13520AA_permease_228-102 aa

PF15086UPF054275-97 aa

PF24432DUF755596-114 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G030990	`PF24432`	DUF7555	25	68	0.15	12.8
TkA06G030990	`PF13520`	AA_permease_2	28	102	0.093	12.3
TkA06G030990	`PF15086`	UPF0542	75	97	0.043	14.4
TkA06G030990	`PF24432`	DUF7555	96	114	0.15	12.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C6S5`	Arabidopsis thaliana	sp\|Q9C6S5\|PHSB_ARATH Probable polyamine transporter At1g31830	70.300%	Swiss-Prot	High
`Q9FFL1`	Arabidopsis thaliana	sp\|Q9FFL1\|RMV1_ARATH Polyamine transporter RMV1	70.400%	Swiss-Prot	High
`Q9C6S4`	Arabidopsis thaliana	sp\|Q9C6S4\|PHSA_ARATH Probable polyamine transporter At1g31820	65.500%	Swiss-Prot	High
`A2X8M8`	Oryza sativa subsp. indica	sp\|A2X8M8\|PUT1_ORYSI Polyamine transporter PUT1	65.100%	Swiss-Prot	High
`Q6Z8D0`	Oryza sativa subsp. japonica	sp\|Q6Z8D0\|PUT1_ORYSJ Polyamine transporter PUT1	65.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card