LXL04_026031 | RubberDandelionOmics

Gene overview

LXL04_026031

Reference: OH-1004 Chr: Chr05 Coordinates: 119936485-119942153 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1767 bp · LXL04_026031|LXL04_026031|OH1004|cDNA

aTGGCGCCAATAACTGCTATATTAACCACACCATCAAAACAGGGTTCAGAAGAACGACCACCGCTCGCTTCCCCTGGTAATCAAACAGCTCCACAGACCGCCGCGCCGTCGAATTTACCGGCTAAAAGTTCCGTTTCCGTTGATTTCACTAACAAAGGTACAGTAGCCGATGGAGGAAGGCTTAAAGGTTATTCGACGCCTGAATTGTCCGGTAAGATCTCCGTTGATGGCACCGCCAAGATCAATGCTGACGGTGATGA...

CDS

Download CDS FASTA

1767 bp · LXL04_026031|LXL04_026031|OH1004|CDS

ATGGCGCCAATAACTGCTATATTAACCACACCATCAAAACAGGGTTCAGAAGAACGACCACCGCTCGCTTCCCCTGGTAATCAAACAGCTCCACAGACCGCCGCGCCGTCGAATTTACCGGCTAAAAGTTCCGTTTCCGTTGATTTCACTAACAAAGGTACAGTAGCCGATGGAGGAAGGCTTAAAGGTTATTCGACGCCTGAATTGTCCGGTAAGATCTCCGTTGATGGCACCGCCAAGATCAATGCTGACGGTGATGA...

Protein

Download Protein FASTA

588 aa · LXL04_026031|LXL04_026031|OH1004|PROTEIN

MAPITAILTTPSKQGSEERPPLASPGNQTAPQTAAPSNLPAKSSVSVDFTNKGTVADGGRLKGYSTPELSGKISVDGTAKINADGDEIDSHHYHEDPPYLVKLKNTDNRQASLAMGQNSDVEYIGITESPSPTRLPTTNTKRISIIPLIFLIFYEVSGGPFGVEDSVRAAGPLLALIGFLVFPFIWSIPEALITAEMGTMFPEDGGYVVWVSSALGPYWGFQQGWMKWLSGVIDNALYPVLFLDYLKSGIPILADGYPRV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026031`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026031

Location Chr05:119936485-119942153 (-)

Description Similar to At1g31830: Probable polyamine transporter At1g31830

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g31830`	Probable cell membrane polyamine/proton symporter involved in the polyamine uptake in cells.	No verified direct reference in this release
`At5g05630`	Cell membrane polyamine/proton symporter involved in the polyamine uptake in cells.	Natural variation in a polyamine transporter determines paraquat tolerance in Arabidopsis.2012 · DOI: 10.1073/pnas.1121406109
`At1g31820`	Probable cell membrane polyamine/proton symporter involved in the polyamine uptake in cells.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0700500`	Cell membrane polyamine/proton symporter involved in the polyamine uptake in cells.	Functional analysis of OsPUT1, a rice polyamine uptake transporter.2012 · DOI: 10.1007/s00425-011-1486-9
`UniProt: A2X8M8`	Cell membrane polyamine/proton symporter involved in the polyamine uptake in cells.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026031 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009408 response to heat Biological Process

GO:0015839 cadaverine transport Biological Process

GO:0015846 polyamine transport Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0015203 polyamine transmembrane transporter activity Molecular Function

GO:0015293 symporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G31820

ath:AT1G31830

ath:AT5G05630

dosa:Os02g0700500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.376

Rank 1 · LXL04_026031 · OH-1004

Lysosome / Vacuole0.275

Rank 2 · LXL04_026031 · OH-1004

Cytoplasm0.147

Rank 3 · LXL04_026031 · OH-1004

Endoplasmic reticulum0.136

Rank 4 · LXL04_026031 · OH-1004

Golgi apparatus0.133

Rank 5 · LXL04_026031 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13520.13AA_permease_2148-537 aa

PF00324.28AA_permease166-546 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026031	`PF13520.13`	AA_permease_2	148	537	6.4e-39	134.8
LXL04_026031	`PF00324.28`	AA_permease	166	546	5.7e-19	68.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C6S5`	Arabidopsis thaliana	Probable polyamine transporter At1g31830	72.895%	Swiss-Prot	strong database homology
`Q9FFL1`	Arabidopsis thaliana	Polyamine transporter RMV1	72.826%	Swiss-Prot	strong database homology
`Q9C6S4`	Arabidopsis thaliana	Probable polyamine transporter At1g31820	69.042%	Swiss-Prot	strong database homology
`Q6Z8D0`	Oryza sativa subsp. japonica	Polyamine transporter PUT1	68.987%	Swiss-Prot	strong database homology
`A2X8M8`	Oryza sativa subsp. indica	Polyamine transporter PUT1	68.987%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card