RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA06G027530
Reference: TK1151 Chr: Chr06 Coordinates: 7441343-7444233 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2002 bp · TkA06G027530|TK1151|cDNA

AAAAAACAGGAGGTTTTTTAATTTCTCAATGAAAAAAAAAACTATAAATTACAGAACAGAGTCATTAGCTACGTCCCCACTCTCCACGTGTCCCTTTTTCGGATCGCCGGCAATGCAATACCTGCTCTTCCACCACCACCACATCCTTCCCCTGTAAATCATTTCATTTCTCTCACCTCAATCGGCGCCATAATTTGCGATTTCGATCAATACCAGCTACGATCACCTTAGCAGAACAAGGTTTCAGTAATTCACGGCTT...

CDS

Download CDS FASTA

831 bp · TkA06G027530|TK1151|CDS

ATGAGTTTTCAAGATATCGAAGCTGGTCGCCCGGTCAATTCGAGACGCGCGGGCTACAACAATGGCATGAGGAAACAGGATCCGACTCAAGCTGTTGCTTCTGGAATTTTCCAGATCAATACGGCAGTCTCTACGTTTCAGAGGCTAGTGAATACCCTTGGTACTCCTAAAGACACCCCTGAGCTTCGAGAAAAGCTGCACAAAACCAGACTACATATTGGGCAGCTGGTGAAGGATACTTCAGATAAACTCAAACAAGC...

Protein

Download Protein FASTA

276 aa · TkA06G027530|TK1151|PROTEIN

MSFQDIEAGRPVNSRRAGYNNGMRKQDPTQAVASGIFQINTAVSTFQRLVNTLGTPKDTPELREKLHKTRLHIGQLVKDTSDKLKQASETDHKTDVSASKKITDAKLAKDFQSVLKEFQKAQRLSAERETAYTPFVPQSSLPSRDPDSEMDVSSDKTQEQRVLLVDSKRQEVLLLDNEIAFNEAIIEERDQGIHEIQNQIGEVNEIFKDLAVLVHDQGAMIDDIGTNIENSHAATTQAKSHLAKASKTQRSNSSMTCLLL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA06G027530
TK1151 IDTkA06G027530
OH-1004 IDLXL04_026101
Relationship / confidenceRbh Sequence Supported / Probable
Protein identity (%)92.600
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA06G027530
LocationChr06:7441343-7444233 (+)
DescriptionSimilar to SYP22: Syntaxin-22
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g46860 May provide the t-SNARE function in the vacuolar assembly.
The occurrence of 'bulbs', a complex configuration of the vacuolar membrane, is affected by mutations of vacuolar SNARE and phospholipase in Arabidopsis.2011 · DOI: 10.1111/j.1365-313x.2011.04665.x
SGR1, SGR2, SGR3: novel genetic loci involved in shoot gravitropism in Arabidopsis thaliana.1996 · DOI: 10.1104/pp.110.3.945
At4g17730 May function in the docking or fusion of transport vesicles with the prevacuolar membrane. No verified direct reference in this release
At5g16830 May function in the docking or fusion of transport vesicles with the prevacuolar membrane. No verified direct reference in this release
At1g32270 Vesicle trafficking protein that functions in the secretory pathway. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_026101 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006623 protein targeting to vacuole Biological Process
GO:0006886 intracellular protein transport Biological Process
GO:0006891 intra-Golgi vesicle-mediated transport Biological Process
GO:0006896 Golgi to vacuole transport Biological Process
GO:0006906 vesicle fusion Biological Process
GO:0008333 endosome to lysosome transport Biological Process
GO:0009597 detection of virus Biological Process
GO:0009660 amyloplast organization Biological Process
GO:0009959 negative gravitropism Biological Process
GO:0010118 stomatal movement Biological Process
GO:0016189 synaptic vesicle to endosome fusion Biological Process
GO:0016192 vesicle-mediated transport Biological Process
KEGG gene cross-reference
ath:AT1G32270
ath:AT4G17730
ath:AT5G16830
ath:AT5G46860
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.330
Rank 1 · TkA06G027530 · TK1151
Cytoplasm0.307
Rank 2 · TkA06G027530 · TK1151
Golgi apparatus0.284
Rank 3 · TkA06G027530 · TK1151
Cell membrane0.193
Rank 4 · TkA06G027530 · TK1151
Endoplasmic reticulum0.129
Rank 5 · TkA06G027530 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14523Syntaxin_229-161 aa
PF00015MCPsignal29-50 aa
PF07889DUF166431-54 aa
PF29732Syntaxin_R9BP38-119 aa
PF31037DUF877741-92 aa
PF24161CCDC3957-122 aa
PF09548Spore_III_AB59-118 aa
PF07889DUF166461-99 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA06G027530PF14523Syntaxin_2291616.1e-38130.6
TkA06G027530PF00015MCPsignal29500.03514.7
TkA06G027530PF07889DUF166431549.77.0
TkA06G027530PF29732Syntaxin_R9BP381194.5e-0627.2
TkA06G027530PF31037DUF877741920.5511.0
TkA06G027530PF24161CCDC39571220.02513.2
TkA06G027530PF09548Spore_III_AB591180.008916.6
TkA06G027530PF07889DUF166461999.77.0
TkA06G027530PF00015MCPsignal741040.03514.7
TkA06G027530PF05739SNARE76916.2e-2690.8
TkA06G027530PF00957Synaptobrevin77900.4211.3
TkA06G027530PF28258MSC_0620_UU052821210.01514.5
TkA06G027530PF28019HmpF851200.569.3
TkA06G027530PF06024Orf78871020.1113.5
TkA06G027530PF28019HmpF1592490.569.3
TkA06G027530PF09548Spore_III_AB1602140.008916.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
P93654Arabidopsis thalianasp|P93654|SYP22_ARATH Syntaxin-2263.300%Swiss-ProtHigh
O04378Arabidopsis thalianasp|O04378|SYP23_ARATH Syntaxin-2362.000%Swiss-ProtHigh
Q39233Arabidopsis thalianasp|Q39233|SYP21_ARATH Syntaxin-2157.100%Swiss-ProtHigh
Q9C615Arabidopsis thalianasp|Q9C615|SYP24_ARATH Putative syntaxin-2460.400%Swiss-ProtHigh

JBrowse

View in Genome Browser