TkA06G026580 | RubberDandelionOmics

Gene overview

TkA06G026580

Reference: TK1151 Chr: Chr06 Coordinates: 7163596-7164510 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

876 bp · TkA06G026580|TK1151|cDNA

ATGTCGACAAACCCCACACATGCCGCACCACCTACGATACCATACGCATCTCCTCCTATTACCGTCATCCTCACCATTATTCTCCTCCTGTGCTTCATGCAAAACCTATTTTACACGTGGCATCACCGGCAAAGTCCGTCGTCTAGGGCACCTACTGTTCCCGGAACGGATAACGCCACCCTTGGACTCGACCCTTCCATCATCAAAACTTTTCCGACGTTCACATACTCAGAAGTCAAAGAATATCGAGGGAAAAACTA...

CDS

Download CDS FASTA

876 bp · TkA06G026580|TK1151|CDS

ATGTCGACAAACCCCACACATGCCGCACCACCTACGATACCATACGCATCTCCTCCTATTACCGTCATCCTCACCATTATTCTCCTCCTGTGCTTCATGCAAAACCTATTTTACACGTGGCATCACCGGCAAAGTCCGTCGTCTAGGGCACCTACTGTTCCCGGAACGGATAACGCCACCCTTGGACTCGACCCTTCCATCATCAAAACTTTTCCGACGTTCACATACTCAGAAGTCAAAGAATATCGAGGGAAAAACTA...

Protein

Download Protein FASTA

291 aa · TkA06G026580|TK1151|PROTEIN

MSTNPTHAAPPTIPYASPPITVILTIILLLCFMQNLFYTWHHRQSPSSRAPTVPGTDNATLGLDPSIIKTFPTFTYSEVKEYRGKNYGLECAICLCEFKDENMLRLLTKCCHIFHQECIDLWLGSHKSCPWCRSSLDTPINSPEKSPVSVASTGGMHEVQENGSHGDRSVSIDIRDNNENGDKEESKMEKHVSIKVDDDRGREGGHKSTDGFMRSKSTGHSIIRNAKRCENDERYTLRLPQDVQAKLIPRHNWTRSCTEF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G026580`
TK1151 ID	TkA06G026580
OH-1004 ID	LXL04_026133
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 98.625 / OH-1004 84.412 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G026580

Location Chr06:7163596-7164510 (-)

Description Similar to ATL30: RING-H2 finger protein ATL30

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g46650`	RING-H2 finger protein ATL30.	No verified direct reference in this release
`At4g17920`	RING-H2 finger protein ATL29.	No verified direct reference in this release
`At1g72200`	RING-H2 finger protein ATL11.	No verified direct reference in this release
`At3g05200`	E3 ubiquitin-protein ligase able to catalyze polyubiquitination with ubiquitin-conjugating enzyme E2 UBC8 in vitro.	No verified direct reference in this release
`At2g35000`	E3 ubiquitin-protein ligase able to catalyze polyubiquitination with ubiquitin-conjugating enzyme E2 UBC8 in vitro.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026133 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010200 response to chitin Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0098542 defense response to other organism Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0004842 ubiquitin-protein transferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G72200

ath:AT2G35000

ath:AT3G05200

ath:AT4G17920

ath:AT5G46650

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.419

Rank 1 · TkA06G026580 · TK1151

Cytoplasm0.260

Rank 2 · TkA06G026580 · TK1151

Nucleus0.226

Rank 3 · TkA06G026580 · TK1151

Endoplasmic reticulum0.139

Rank 4 · TkA06G026580 · TK1151

Lysosome / Vacuole0.118

Rank 5 · TkA06G026580 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05883Baculo_RING87-134 aa

PF13639zf-RING_290-133 aa

PF17123zf-RING_1190-119 aa

PF13923zf-C3HC4_290-132 aa

PF14634zf-RING_590-133 aa

PF13445zf-RING_UBOX91-130 aa

PF00097zf-C3HC491-132 aa

PF17120zf-RING_1694-130 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G026580	`PF05883`	Baculo_RING	87	134	0.065	13.9
TkA06G026580	`PF13639`	zf-RING_2	90	133	2.9e-12	47.3
TkA06G026580	`PF17123`	zf-RING_11	90	119	2.1e-08	34.4
TkA06G026580	`PF13923`	zf-C3HC4_2	90	132	1e-06	29.1
TkA06G026580	`PF14634`	zf-RING_5	90	133	0.00031	21.4
TkA06G026580	`PF13445`	zf-RING_UBOX	91	130	6e-06	26.9
TkA06G026580	`PF00097`	zf-C3HC4	91	132	0.00037	21.0
TkA06G026580	`PF17120`	zf-RING_16	94	130	0.43	11.0
TkA06G026580	`PF12678`	zf-rbx1	95	133	1.5e-05	25.8
TkA06G026580	`PF12861`	zf-ANAPC11	95	136	0.00052	20.7
TkA06G026580	`PF23555`	zf-RING_Vps41	109	120	1.0	9.8
TkA06G026580	`PF25143`	Zn_ribbon_IFT122_C	110	138	0.0082	16.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FIR0`	Arabidopsis thaliana	sp\|Q9FIR0\|ATL30_ARATH RING-H2 finger protein ATL30	37.700%	Swiss-Prot	Medium
`O49691`	Arabidopsis thaliana	sp\|O49691\|ATL29_ARATH RING-H2 finger protein ATL29	34.500%	Swiss-Prot	Medium
`Q84W40`	Arabidopsis thaliana	sp\|Q84W40\|ATL11_ARATH RING-H2 finger protein ATL11	34.300%	Swiss-Prot	Medium
`Q8RXX9`	Arabidopsis thaliana	sp\|Q8RXX9\|ATL6_ARATH E3 ubiquitin-protein ligase ATL6	33.300%	Swiss-Prot	Medium
`O64763`	Arabidopsis thaliana	sp\|O64763\|ATL9_ARATH E3 ubiquitin-protein ligase ATL9	34.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card