TkA06G021250 | RubberDandelionOmics

Gene overview

TkA06G021250

Reference: TK1151 Chr: Chr06 Coordinates: 5790068-5792523 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1677 bp · TkA06G021250|TK1151|cDNA

CAGAAATAACCTATTCCAGTCTATTAAAAAACAATACCTTTTTATGTTTCTAAATACCTTTTTTTGTTTCTAATAGAACAACCCATTTATGTAAGCCATGACCAGTGCCGCATTTACAATTGTTGCACTATGGCATGCTCTGTGCCATATTTAAAACGCATAAAACATGAAAAACGCCGCCGATTTATCTGACCGTCACAGAAGCTTCACGCTCGTCATCTCAGATCTGCCATGGCGATCGCAATGGGGTTTGCTACCCC...

CDS

Download CDS FASTA

1269 bp · TkA06G021250|TK1151|CDS

ATGGCGATCGCAATGGGGTTTGCTACCCCAGTTAGGTTTAAGACCACCCCTATAATCAACCACAGCGATCACCGCCACGCGCTTGACGCATCGTATGTAAAACGCGCCGCCGAGTTATCTGACCTGTCTGCGGGTTTCACCCCGCCGCATCCTAACTTCGGTTGCGTGATAGCAAAAACCAGCAGCGTGGGGAATCATAAGGTTTTCGGAGAAGGGTATCTATACGCGCAAGGGACGAAACCGGCGGAGGTCCAGGCGGT...

Protein

Download Protein FASTA

422 aa · TkA06G021250|TK1151|PROTEIN

MAIAMGFATPVRFKTTPIINHSDHRHALDASYVKRAAELSDLSAGFTPPHPNFGCVIAKTSSVGNHKVFGEGYLYAQGTKPAEVQAVEAAGEYCRGATAYVNMEPGDCDGDNTALSAFVKAGITRVVIGIRHPLQHLRGKAVQTLRNEGLQVDVLGEDIQGVSMEDALKSCLHVNAPFLYRSVYQVPFSVLKYAMTLDGKIATSSGHSLWISSKKSRSRVFELRGRSDAVIVGGNTVRKDNPRLTPRNGGTHLPTRIVMS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G021250`
TK1151 ID	TkA06G021250
OH-1004 ID	LXL04_025943
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	79.500
Protein coverage (%)	TK1151 98.578 / OH-1004 70.064 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G021250

Location Chr06:5790068-5792523 (-)

Description Similar to PYRR: Riboflavin biosynthesis protein PYRR, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g47390`	Pyrimidine reductase involved in the riboflavin biosynthesis pathway.	Identification and characterization of the missing pyrimidine reductase in the plant riboflavin biosynthesis pathway.2013 · DOI: 10.1104/pp.112.208488

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025943 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009231 riboflavin biosynthetic process Biological Process

GO:0009644 response to high light intensity Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0046443 FAD metabolic process Biological Process

GO:1901135 carbohydrate derivative metabolic process Biological Process

GO:0009507 chloroplast Cellular Component

GO:0008270 zinc ion binding Molecular Function

GO:0008703 5-amino-6-(5-phosphoribosylamino)uracil reductase activity Molecular Function

GO:0008835 diaminohydroxyphosphoribosylaminopyrimidine deaminase activity Molecular Function

GO:0016799 hydrolase activity, hydrolyzing N-glycosyl compounds Molecular Function

GO:0017113 dihydropyrimidine dehydrogenase (NADP+) activity Molecular Function

GO:0050661 NADP binding Molecular Function

KEGG gene cross-reference

aae:aq_138

ath:AT3G47390

syn:slr0066

zma:101202729

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.927

Rank 1 · TkA06G021250 · TK1151

Mitochondrion0.085

Rank 2 · TkA06G021250 · TK1151

Cytoplasm0.059

Rank 3 · TkA06G021250 · TK1151

Nucleus0.036

Rank 4 · TkA06G021250 · TK1151

Peroxisome0.031

Rank 5 · TkA06G021250 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00383dCMP_cyt_deam_131-129 aa

PF26843Kil_protein120-146 aa

PF01872RibD_C188-391 aa

PF26843Kil_protein291-315 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G021250	`PF00383`	dCMP_cyt_deam_1	31	129	0.00053	20.6
TkA06G021250	`PF26843`	Kil_protein	120	146	0.053	14.0
TkA06G021250	`PF01872`	RibD_C	188	391	9.6e-43	147.0
TkA06G021250	`PF26843`	Kil_protein	291	315	0.053	14.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9STY4`	Arabidopsis thaliana	sp\|Q9STY4\|RIBRX_ARATH Riboflavin biosynthesis protein PYRR, chloroplastic	69.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card