LXL04_025943 | RubberDandelionOmics

Gene overview

LXL04_025943

Reference: OH-1004 Chr: Chr05 Coordinates: 118824750-118827920 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1947 bp · LXL04_025943|LXL04_025943|OH1004|cDNA

TACGAATTGGCTGGGCTAATCCATCTCACCGCCACAGGAACTCGCTATCTCTGATTTGCGATGGCGATGGCGATGGCGATGGCAATGGGGTTTGCTACCGCAGTTAAGTTTAAGGCCAGCTCTATCATCAACAACAGTGATCACAACCATGCGCTTGATGCATCGTATGTGAAACGCGCCGCCGAGTTATCTGACAAGTCAGCCGGTTTTACCTCACCGCATCCTAACTTTGGTTGCGTGATATCAACTACCAGCAGCTC...

CDS

Download CDS FASTA

1887 bp · LXL04_025943|LXL04_025943|OH1004|CDS

ATGGCGATGGCGATGGCGATGGCAATGGGGTTTGCTACCGCAGTTAAGTTTAAGGCCAGCTCTATCATCAACAACAGTGATCACAACCATGCGCTTGATGCATCGTATGTGAAACGCGCCGCCGAGTTATCTGACAAGTCAGCCGGTTTTACCTCACCGCATCCTAACTTTGGTTGCGTGATATCAACTACCAGCAGCTCGAGGAATGTCGTCGGAGAAGGATATCTTTACGCGCAAGGGACGAAGCCGGCCGAGGTTCA...

Protein

Download Protein FASTA

628 aa · LXL04_025943|LXL04_025943|OH1004|PROTEIN

MAMAMAMAMGFATAVKFKASSIINNSDHNHALDASYVKRAAELSDKSAGFTSPHPNFGCVISTTSSSRNVVGEGYLYAQGTKPAEVQAVEAAGEYCRGATAYVNMEPGDCDGDNTALSALIQAGISRVVIGIRHPLQHLRGKAIQALRSEGLQVDVLGEDLRSVSMEDALKSCLLVNAPLLYRSASRVPFSVLKYAMTLDGEYHTITIIFIQTCYICTISSPFLTGKIAASSGHASWISSKKSRSRVFELRGRSDAVIVG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025943`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025943

Location Chr05:118824750-118827920 (-)

Description Similar to PYRR: Riboflavin biosynthesis protein PYRR, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g47390`	Pyrimidine reductase involved in the riboflavin biosynthesis pathway.	Identification and characterization of the missing pyrimidine reductase in the plant riboflavin biosynthesis pathway.2013 · DOI: 10.1104/pp.112.208488

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025943 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009231 riboflavin biosynthetic process Biological Process

GO:0009644 response to high light intensity Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0046443 FAD metabolic process Biological Process

GO:1901135 carbohydrate derivative metabolic process Biological Process

GO:0009507 chloroplast Cellular Component

GO:0008270 zinc ion binding Molecular Function

GO:0008703 5-amino-6-(5-phosphoribosylamino)uracil reductase activity Molecular Function

GO:0008835 diaminohydroxyphosphoribosylaminopyrimidine deaminase activity Molecular Function

GO:0016799 hydrolase activity, hydrolyzing N-glycosyl compounds Molecular Function

GO:0017113 dihydropyrimidine dehydrogenase (NADP+) activity Molecular Function

GO:0050661 NADP binding Molecular Function

KEGG gene cross-reference

aae:aq_138

ath:AT3G47390

syn:slr0066

zma:101202729

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.805

Rank 1 · LXL04_025943 · OH-1004

Cytoplasm0.137

Rank 2 · LXL04_025943 · OH-1004

Mitochondrion0.102

Rank 3 · LXL04_025943 · OH-1004

Nucleus0.083

Rank 4 · LXL04_025943 · OH-1004

Peroxisome0.072

Rank 5 · LXL04_025943 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00383.30dCMP_cyt_deam_135-131 aa

PF01872.23RibD_C226-418 aa

PF08719.18NADAR455-608 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025943	`PF00383.30`	dCMP_cyt_deam_1	35	131	9.6e-07	29.4
LXL04_025943	`PF01872.23`	RibD_C	226	418	2.7e-39	135.7
LXL04_025943	`PF08719.18`	NADAR	455	608	1.2e-34	120.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9STY4`	Arabidopsis thaliana	Riboflavin biosynthesis protein PYRR, chloroplastic	64.734%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card