RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA06G008720
Reference: TK1151 Chr: Chr06 Coordinates: 2202664-2206091 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1621 bp · TkA06G008720|TK1151|cDNA

TTTTTCTCTTTCTTGATCAAGTCACATAAATTGAAAGGAAATAAATTGAAAAAGAAAAGAAATTTTTTATCTTTAATTTTGTCTCTGAGGTTTGTTTCTTTTTCCTGTATTGATCACCATCTAACCCTGAAAATCTCTTTAGAAAGAGAAATATGGATCCTTTTTATGCTTAAATCTGTGACTTCACAGAACTGGTCCAGAAAGTTTTCTTGTCTCTGATCCCAATAAGGCCATCTCTCTCTTACAAAAGATCTGTAATC...

CDS

Download CDS FASTA

897 bp · TkA06G008720|TK1151|CDS

ATGCAAGAACAAGGATTAGGGATGATTGGTGGCAGTGGAGGGATTGGTGGTGCTTTTACAGATATGGCCGTCTCACTTTCCGGCGATCAGAACCGCCAGCTCAAGGCGGAGATAGCCAACCACCCACTCTACGAACAGCTTCTCTCAGCTCATGTAGCATGTCTCCGGGTCGCCACGCCGATTGATCAGCTGCCGCTCATCGACGCCCAGCTCTCCCAGTCCCACCACCTCCTCCGCTCTTACATCGCCGACCACCACAA...

Protein

Download Protein FASTA

298 aa · TkA06G008720|TK1151|PROTEIN

MQEQGLGMIGGSGGIGGAFTDMAVSLSGDQNRQLKAEIANHPLYEQLLSAHVACLRVATPIDQLPLIDAQLSQSHHLLRSYIADHHNQPLSPHDRQDLDNFLAQYLLVLCSFKEQLQQHVRVHAVEAVMACREIEHNLQALTGVTLGEGSGATMSDDEDEMPMDFSLDQSGGMDGGHDMMGFGPLLPTESERSLMERVRQELKIELKQGFRSKIEDVREEILRKRRAGKLPGDTTSVLKDWWQQHSKWPYPTEDDKAKLV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA06G008720
TK1151 IDTkA06G008720
OH-1004 IDLXL04_026496
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)100.000
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA06G008720
LocationChr06:2202664-2206091 (+)
DescriptionSimilar to KNAT7: Homeobox protein knotted-1-like 7
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g62990 May be involved in secondary cell wall biosynthesis. No verified direct reference in this release
At5g25220 Homeobox protein knotted-1-like 3. No verified direct reference in this release
At5g11060 Homeobox protein knotted-1-like 4. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os03g0123500 Homeobox protein knotted-1-like 3. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_026496 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0006357 regulation of transcription by RNA polymerase II Biological Process
GO:0009416 response to light stimulus Biological Process
GO:0009722 detection of cytokinin stimulus Biological Process
GO:0010089 xylem development Biological Process
GO:0010192 mucilage biosynthetic process Biological Process
GO:0010214 seed coat development Biological Process
GO:0045892 negative regulation of DNA-templated transcription Biological Process
GO:0071345 cellular response to cytokine stimulus Biological Process
GO:0080001 mucilage extrusion from seed coat Biological Process
GO:0080112 seed growth Biological Process
GO:2000652 regulation of secondary cell wall biogenesis Biological Process
KEGG gene cross-reference
ath:AT1G62990
ath:AT5G11060
ath:AT5G25220
bna:106394496
dosa:Os03g0123500
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.962
Rank 1 · TkA06G008720 · TK1151
Cytoplasm0.176
Rank 2 · TkA06G008720 · TK1151
Mitochondrion0.019
Rank 3 · TkA06G008720 · TK1151
Cell membrane0.014
Rank 4 · TkA06G008720 · TK1151
Golgi apparatus0.007
Rank 5 · TkA06G008720 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03790KNOX134-75 aa
PF03789ELK75-80 aa
PF03790KNOX177-83 aa
PF03791KNOX292-142 aa
PF03789ELK113-118 aa
PF03789ELK201-222 aa
PF24936DUF7753215-244 aa
PF05920Homeobox_KN241-280 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA06G008720PF03790KNOX134752e-1969.8
TkA06G008720PF03789ELK75800.03814.6
TkA06G008720PF03790KNOX177832e-1969.8
TkA06G008720PF03791KNOX2921424e-1762.2
TkA06G008720PF03789ELK1131180.03814.6
TkA06G008720PF03789ELK2012220.03814.6
TkA06G008720PF24936DUF77532152440.02715.1
TkA06G008720PF05920Homeobox_KN2412801.8e-1970.0
TkA06G008720PF00046Homeodomain2472802.4e-0524.8
TkA06G008720PF23739HTH_722582810.08913.5
TkA06G008720PF24936DUF77532632850.02715.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9FPQ8Arabidopsis thalianasp|Q9FPQ8|KNAT7_ARATH Homeobox protein knotted-1-like 777.700%Swiss-ProtHigh
P48000Arabidopsis thalianasp|P48000|KNAT3_ARATH Homeobox protein knotted-1-like 372.100%Swiss-ProtHigh
P48001Arabidopsis thalianasp|P48001|KNAT4_ARATH Homeobox protein knotted-1-like 470.900%Swiss-ProtHigh
Q94LW3Oryza sativa subsp. japonicasp|Q94LW3|KNOS3_ORYSJ Homeobox protein knotted-1-like 376.400%Swiss-ProtHigh

JBrowse

View in Genome Browser