RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA05G475290
Reference: TK1151 Chr: Chr05 Coordinates: 119306348-119307613 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

651 bp · TkA05G475290|TK1151|cDNA

ATGTTCCCCCCTTTTATTGTTAGCTTTGCCCCGGCTCAACTCGTTATTCCTTCCGTTCCTCCCCCTAAATTGGACGAGTTAGGTGATGATTCTAACCGAGTTCCCTCCCCCCGGTCTCCTGGAAATGATGATGATGCTTCTGCTCATGAGGATCCTCCTATCGCCGAGCCCAGATCTCCTTCTGACAATGTTCCTAAGGAAAAAACTGATGGGAGTAGCGTCGTTCTGTTATCTGTTTCCTTCGCATCTTCCACCTTTCA...

CDS

Download CDS FASTA

651 bp · TkA05G475290|TK1151|CDS

ATGTTCCCCCCTTTTATTGTTAGCTTTGCCCCGGCTCAACTCGTTATTCCTTCCGTTCCTCCCCCTAAATTGGACGAGTTAGGTGATGATTCTAACCGAGTTCCCTCCCCCCGGTCTCCTGGAAATGATGATGATGCTTCTGCTCATGAGGATCCTCCTATCGCCGAGCCCAGATCTCCTTCTGACAATGTTCCTAAGGAAAAAACTGATGGGAGTAGCGTCGTTCTGTTATCTGTTTCCTTCGCATCTTCCACCTTTCA...

Protein

Download Protein FASTA

216 aa · TkA05G475290|TK1151|PROTEIN

MFPPFIVSFAPAQLVIPSVPPPKLDELGDDSNRVPSPRSPGNDDDASAHEDPPIAEPRSPSDNVPKEKTDGSSVVLLSVSFASSTFHESLFVAGSATTASTLAYFRRFQSSEQPHQLCFATVKRKQPPPRPLQSFLHPFPVIVQPKTRKKDPPRQPRLVCEFHCFSLRFLPTLGVVFSFSGDHHHHRPPWPWWLWVVVRFLLSKMIPMAVVCLILE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA05G475290
TK1151 IDTkA05G475290
OH-1004 IDLXL04_013725
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)48.500
Protein coverage (%)TK1151 43.056 / OH-1004 7.344
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA05G475290
LocationChr05:119306348-119307613 (-)
DescriptionSimilar to SCL15: Scarecrow-like protein 15
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_013725 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0006357 regulation of transcription by RNA polymerase II Biological Process
GO:0007623 circadian rhythm Biological Process
GO:0009610 response to symbiotic fungus Biological Process
GO:0009737 response to abscisic acid Biological Process
GO:0009740 gibberellic acid mediated signaling pathway Biological Process
GO:0009938 negative regulation of gibberellic acid mediated signaling pathway Biological Process
GO:0010187 negative regulation of seed germination Biological Process
GO:0016036 cellular response to phosphate starvation Biological Process
GO:0030154 cell differentiation Biological Process
GO:0036377 arbuscular mycorrhizal association Biological Process
KEGG gene cross-reference
ath:AT2G45160
ath:AT3G60630
ath:AT4G00150
ath:AT4G36710
mtr:25489240
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.457
Rank 1 · TkA05G475290 · TK1151
Cytoplasm0.394
Rank 2 · TkA05G475290 · TK1151
Cell membrane0.173
Rank 3 · TkA05G475290 · TK1151
Endoplasmic reticulum0.107
Rank 4 · TkA05G475290 · TK1151
Mitochondrion0.057
Rank 5 · TkA05G475290 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser