LXL04_013725 | RubberDandelionOmics

Gene overview

LXL04_013725

Reference: OH-1004 Chr: Chr03 Coordinates: 34790684-34796291 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4047 bp · LXL04_013725|LXL04_013725|OH1004|cDNA

ATGAAATTGCCGTTTGCTTCATCGCAAAACAATCTCAACTCTGCCAACGTCAAGCAGCAGGTTACCGGTGGTGGTATCGGAAGTAATCGGTACGAACCGAAATCGGTGCTTGACGTGCGCCGGAGTCCGCCTAGCCCGATTATTGGTAAGTCGTCGGAATTCAATTCTGTTGATCATAATATTGGTGTGTTTTCATCGTCGGAGGAACAGCTGCCGTTGGATAATATTGAACATGGAATGATCCATCAGTTTGAAGAATG...

CDS

Download CDS FASTA

4047 bp · LXL04_013725|LXL04_013725|OH1004|CDS

ATGAAATTGCCGTTTGCTTCATCGCAAAACAATCTCAACTCTGCCAACGTCAAGCAGCAGGTTACCGGTGGTGGTATCGGAAGTAATCGGTACGAACCGAAATCGGTGCTTGACGTGCGCCGGAGTCCGCCTAGCCCGATTATTGGTAAGTCGTCGGAATTCAATTCTGTTGATCATAATATTGGTGTGTTTTCATCGTCGGAGGAACAGCTGCCGTTGGATAATATTGAACATGGAATGATCCATCAGTTTGAAGAATG...

Protein

Download Protein FASTA

1348 aa · LXL04_013725|LXL04_013725|OH1004|PROTEIN

MKLPFASSQNNLNSANVKQQVTGGGIGSNRYEPKSVLDVRRSPPSPIIGKSSEFNSVDHNIGVFSSSEEQLPLDNIEHGMIHQFEEWDSLMRELGLHDDSTKSAYPLDLPELPPIHTEAAPPATTQFFHSDFENLNPNLSALDFMSQDDDDNSNNNENGFDFVDELIRIAECFETRSIQLAQVIMTRLNQRLRAPTGKALQRAAFYFKEALQSLLTGPTRMTQSSSSSEIVQAIKAHKTFSNVSPIPMFSDFTANQAILE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013725`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013725

Location Chr03:34790684-34796291 (-)

Description Similar to SCL15: Scarecrow-like protein 15

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g36710`	Probable transcription factor involved in plant development.	No verified direct reference in this release
`At4g00150`	Probable transcription factor involved in plant development.	No verified direct reference in this release
`At2g45160`	Probable transcription factor involved in plant development.	No verified direct reference in this release
`At3g60630`	Probable transcription factor involved in plant development.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013725 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009610 response to symbiotic fungus Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0009938 negative regulation of gibberellic acid mediated signaling pathway Biological Process

GO:0010187 negative regulation of seed germination Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0030154 cell differentiation Biological Process

GO:0036377 arbuscular mycorrhizal association Biological Process

KEGG gene cross-reference

ath:AT2G45160

ath:AT3G60630

ath:AT4G00150

ath:AT4G36710

mtr:25489240

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.768

Rank 1 · LXL04_013725 · OH-1004

Cytoplasm0.265

Rank 2 · LXL04_013725 · OH-1004

Cell membrane0.044

Rank 3 · LXL04_013725 · OH-1004

Endoplasmic reticulum0.030

Rank 4 · LXL04_013725 · OH-1004

Plastid0.021

Rank 5 · LXL04_013725 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03514.21GRAS163-517 aa

PF04195.18Transposase_28633-695 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013725	`PF03514.21`	GRAS	163	517	2.9e-86	290.4
LXL04_013725	`PF04195.18`	Transposase_28	633	695	9.2e-16	58.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23210`	Arabidopsis thaliana	Scarecrow-like protein 15	50.000%	Swiss-Prot	weak database homology
`O81316`	Arabidopsis thaliana	Scarecrow-like protein 6	35.278%	Swiss-Prot	weak database homology
`Q7XJM8`	Arabidopsis thaliana	Scarecrow-like protein 27	33.983%	Swiss-Prot	weak database homology
`Q9M000`	Arabidopsis thaliana	Scarecrow-like protein 22	34.328%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card