RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA05G471260
Reference: TK1151 Chr: Chr05 Coordinates: 118302717-118305310 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2085 bp · TkA05G471260|TK1151|cDNA

ATGGCGACGTTGGAAGCTTGCATTAAGAACAACATCATTAGAAAGAGAAAGCAACTAATCTTCGAGTTTAAGAGTTTTGGGAAATCAGTAATTGATTTTTCGGGTCCATTTCGTGATAACATCCGATCTTTTCTCGATGAATATGGTGAGCAGATTGAACAACACCAACTAAATGGCTCCGTTTCCAACAATGTATGGTCTACTCTACTTCTTTGTGAATCAAATGGTGCTGTGTTCCCTCTCTATACTATAGAAGAACA...

CDS

Download CDS FASTA

2085 bp · TkA05G471260|TK1151|CDS

ATGGCGACGTTGGAAGCTTGCATTAAGAACAACATCATTAGAAAGAGAAAGCAACTAATCTTCGAGTTTAAGAGTTTTGGGAAATCAGTAATTGATTTTTCGGGTCCATTTCGTGATAACATCCGATCTTTTCTCGATGAATATGGTGAGCAGATTGAACAACACCAACTAAATGGCTCCGTTTCCAACAATGTATGGTCTACTCTACTTCTTTGTGAATCAAATGGTGCTGTGTTCCCTCTCTATACTATAGAAGAACA...

Protein

Download Protein FASTA

694 aa · TkA05G471260|TK1151|PROTEIN

MATLEACIKNNIIRKRKQLIFEFKSFGKSVIDFSGPFRDNIRSFLDEYGEQIEQHQLNGSVSNNVWSTLLLCESNGAVFPLYTIEEHIDDQLLHPFCCHCKSVGWGHHFVCKRRYRFMIPSYGDKQPFKDHDQKKSLELDDSHILHGLIHCNGFGHLISINKLELDSSNFLAETDVMNLWDSICNSLKTRKVSVADVKLERSMELRLIHGVAFQSSWFGNWGYKFCHGSFGVTERKYNGAVRFLAQLHLDNIINDLKTTY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA05G471260
TK1151 IDTkA05G471260
OH-1004 IDLXL04_022490
Relationship / confidenceRbh Sequence Supported / Probable
Protein identity (%)92.100
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA05G471260
LocationChr05:118302717-118305310 (-)
DescriptionSimilar to MMD1: PHD finger protein MALE MEIOCYTE DEATH 1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g66170 Probable transcription factor required for chromosome organization and progression during male meiosis (e.g. microsporogenesis).
The Arabidopsis MALE MEIOCYTE DEATH1 gene encodes a PHD-finger protein that is required for male meiosis.2003 · DOI: 10.1105/tpc.010447
The DUET gene is necessary for chromosome organization and progression during male meiosis in Arabidopsis and encodes a PHD finger protein.2003 · DOI: 10.1242/dev.00827
The PHD Finger Protein MMD1/DUET Ensures the Progression of Male Meiotic Chromosome Condensation and Directly Regulates the Expression of the Condensin Gene CAP-D3.2016 · DOI: 10.1105/tpc.16.00040
Cell-type-dependent histone demethylase specificity promotes meiotic chromosome condensation in Arabidopsis.2020 · DOI: 10.1038/s41477-020-0697-0
At2g01810 PHD finger protein At2g01810. No verified direct reference in this release
At5g22260 Transcriptional activator required for anther and post-meiotic pollen development and maturation. No verified direct reference in this release
At1g33420 PHD finger protein At1g33420. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os09g0449000 Probable transcriptional activator required for tapetal programmed cell death (PCD) and degeneration, and pollen development in anthers.
PERSISTENT TAPETAL CELL1 encodes a PHD-finger protein that is required for tapetal cell death and pollen development in rice.2011 · DOI: 10.1104/pp.111.175760
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_022490 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000212 meiotic spindle organization Biological Process
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0007060 male meiosis chromosome segregation Biological Process
GO:0007140 male meiotic nuclear division Biological Process
GO:0009555 pollen development Biological Process
GO:0010032 meiotic chromosome condensation Biological Process
GO:0010628 positive regulation of gene expression Biological Process
GO:0043068 positive regulation of programmed cell death Biological Process
GO:0048235 pollen sperm cell differentiation Biological Process
GO:0051321 meiotic cell cycle Biological Process
GO:1905821 positive regulation of chromosome condensation Biological Process
KEGG gene cross-reference
ath:AT1G66170
ath:AT2G01810
dosa:Os09g0449000
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.886
Rank 1 · TkA05G471260 · TK1151
Cytoplasm0.150
Rank 2 · TkA05G471260 · TK1151
Cell membrane0.045
Rank 3 · TkA05G471260 · TK1151
Endoplasmic reticulum0.026
Rank 4 · TkA05G471260 · TK1151
Plastid0.017
Rank 5 · TkA05G471260 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00628PHD93-102 aa
PF27744MS1_N115-123 aa
PF27744MS1_N204-247 aa
PF27748MS1_C249-294 aa
PF30811PHD_UBR7-like308-327 aa
PF25874WHD_plant_repro341-418 aa
PF02042RWP-RK341-369 aa
PF02042RWP-RK437-464 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA05G471260PF00628PHD931026.5e-0730.0
TkA05G471260PF27744MS1_N1151231.1e-2177.3
TkA05G471260PF27744MS1_N2042471.1e-2177.3
TkA05G471260PF27748MS1_C2492941.4e-1660.4
TkA05G471260PF30811PHD_UBR7-like3083273.98.2
TkA05G471260PF25874WHD_plant_repro3414188.1e-61202.6
TkA05G471260PF02042RWP-RK3413690.2712.1
TkA05G471260PF02042RWP-RK4374640.2712.1
TkA05G471260PF25874WHD_plant_repro4385228.1e-61202.6
TkA05G471260PF25565Ubiquitin_At1g334205806269.7e-0729.3
TkA05G471260PF20826PHD_56376834.7e-0524.1
TkA05G471260PF00628PHD6396836.5e-0730.0
TkA05G471260PF30811PHD_UBR7-like6446873.98.2
TkA05G471260PF13831PHD_26516840.1112.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q7X6Y7Arabidopsis thalianasp|Q7X6Y7|MMD1_ARATH PHD finger protein MALE MEIOCYTE DEATH 133.900%Swiss-ProtMedium
Q9ZUA9Arabidopsis thalianasp|Q9ZUA9|Y2181_ARATH PHD finger protein At2g0181032.800%Swiss-ProtMedium
Q9FMS5Arabidopsis thalianasp|Q9FMS5|MS1_ARATH PHD finger protein MALE STERILITY 130.200%Swiss-ProtMedium
Q9C810Arabidopsis thalianasp|Q9C810|Y1342_ARATH PHD finger protein At1g3342025.700%Swiss-ProtLow
Q67V61Oryza sativa subsp. japonicasp|Q67V61|PTC1_ORYSJ PHD finger protein PERSISTENT TAPETAL CELL 127.100%Swiss-ProtLow

JBrowse

View in Genome Browser