TkA05G465220 | RubberDandelionOmics

Gene overview

TkA05G465220

Reference: TK1151 Chr: Chr05 Coordinates: 116597653-116600076 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1448 bp · TkA05G465220|TK1151|cDNA

TGCTTTTTGAGCACAAAGTCGCATTTTTTAAACGCAAAGTTTACGGATTCTGCCAACAGTTGCGTTAATTTCGTTTTCTCCCGTTGCCAACACTCTCTTTCTCTCTCTTCGCTCTCTGTTTGCATGGCGGCAGTCCCAGTGAAGATGGTGGAGAAGCCAAACAAGAAGCAGGTGCTTCTCTTCCACTGCGTCGAATCCGAAGAACTTGCTCGCAAAATCGCCGCTCAATCCGACCACATTCAGCTCCAATCCATCAACTG...

CDS

Download CDS FASTA

1107 bp · TkA05G465220|TK1151|CDS

TGCTTTTTGAGCACAAAGTCGCATTTTTTAAACGCAAAGTTTACGGATTCTGCCAACAGTTGCGTTAATTTCGTTTTCTCCCGTTGCCAACACTCTCTTTCTCTCTCTTCGCTCTCTGTTTGCATGGCGGCAGTCCCAGTGAAGATGGTGGAGAAGCCAAACAAGAAGCAGGTGCTTCTCTTCCACTGCGTCGAATCCGAAGAACTTGCTCGCAAAATCGCCGCTCAATCCGACCACATTCAGCTCCAATCCATCAACTG...

Protein

Download Protein FASTA

368 aa · TkA05G465220|TK1151|PROTEIN

CFLSTKSHFLNAKFTDSANSCVNFVFSRCQHSLSLSSLSVCMAAVPVKMVEKPNKKQVLLFHCVESEELARKIAAQSDHIQLQSINWRSFDDGFPNLFINNAQDIRGQHVSFLASFSSPSVIFEQLSVIFALPRLFVASFTLVLPFFPTGSFERMEEEGDVATAFTMARILSNIPISRGGPTSLVIYDIHALQERFYFGDNVLPYFETGIPLLKQRLHQLPDADKIVIAFPDDGAWKRFHKLLDHFPMVVCAKVREGDKR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G465220`
TK1151 ID	TkA05G465220
OH-1004 ID	LXL04_022409
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 99.457 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G465220

Location Chr05:116597653-116600076 (-)

Description Similar to PRS4: Ribose-phosphate pyrophosphokinase 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g42910`	Ribose-phosphate pyrophosphokinase 4.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0714600`	Ribose-phosphate pyrophosphokinase 4.	No verified direct reference in this release
`Os01g0723600`	Ribose-phosphate pyrophosphokinase 3, chloroplastic.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022409 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006015 5-phosphoribose 1-diphosphate biosynthetic process Biological Process

GO:0006164 purine nucleotide biosynthetic process Biological Process

GO:0002189 ribose phosphate diphosphokinase complex Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0004749 ribose phosphate diphosphokinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT2G42910

dosa:Os01g0723600

dosa:Os02g0714600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.799

Rank 1 · TkA05G465220 · TK1151

Mitochondrion0.190

Rank 2 · TkA05G465220 · TK1151

Cytoplasm0.085

Rank 3 · TkA05G465220 · TK1151

Nucleus0.049

Rank 4 · TkA05G465220 · TK1151

Peroxisome0.035

Rank 5 · TkA05G465220 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13793Pribosyltran_N59-173 aa

PF13793Pribosyltran_N263-312 aa

PF00156Pribosyltran264-309 aa

PF14572Pribosyl_synth271-315 aa

PF14220DUF4329284-336 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G465220	`PF13793`	Pribosyltran_N	59	173	5.3e-09	36.7
TkA05G465220	`PF13793`	Pribosyltran_N	263	312	5.3e-09	36.7
TkA05G465220	`PF00156`	Pribosyltran	264	309	1.5e-08	34.8
TkA05G465220	`PF14572`	Pribosyl_synth	271	315	0.0037	17.9
TkA05G465220	`PF14220`	DUF4329	284	336	0.29	11.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q680A5`	Arabidopsis thaliana	sp\|Q680A5\|KPRS4_ARATH Ribose-phosphate pyrophosphokinase 4	80.900%	Swiss-Prot	High
`Q6ZFT5`	Oryza sativa subsp. japonica	sp\|Q6ZFT5\|KPRS4_ORYSJ Ribose-phosphate pyrophosphokinase 4	84.100%	Swiss-Prot	High
`Q8S2E5`	Oryza sativa subsp. japonica	sp\|Q8S2E5\|KPRS3_ORYSJ Ribose-phosphate pyrophosphokinase 3, chloroplastic	74.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card