TkA05G464810 | RubberDandelionOmics

Gene overview

TkA05G464810

Reference: TK1151 Chr: Chr05 Coordinates: 116457019-116461456 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2783 bp · TkA05G464810|TK1151|cDNA

AGTCGTAAATCCATAACAGAGGACAGTTCATTGCACAACCCACCGGTAGAAGGTCACCGCCGATCACTAGATGGCAGGCGTTTCCATCGCCGCAGAATGGCAACTTCTCGGCGACAAGTACTACCGAAAGCCAGAGCTCTATCAATTACGATGGAAAAACATCGATCTTGCTCGAAACAAGGTCGCCTGCGCCCCATTCGGCGGTCCAATTGCCGTCATTCGCGACGAGTCCAAGATCGTCCAGCTCTACGCCGAATCCG...

CDS

Download CDS FASTA

2526 bp · TkA05G464810|TK1151|CDS

ATGGCAGGCGTTTCCATCGCCGCAGAATGGCAACTTCTCGGCGACAAGTACTACCGAAAGCCAGAGCTCTATCAATTACGATGGAAAAACATCGATCTTGCTCGAAACAAGGTCGCCTGCGCCCCATTCGGCGGTCCAATTGCCGTCATTCGCGACGAGTCCAAGATCGTCCAGCTCTACGCCGAATCCGCCCTTCGTAAACTCCGAATTTTCAACTCCGCCGGCCGACAAATCTCCGAAACCGTTTGGAGAAACCCCGG...

Protein

Download Protein FASTA

841 aa · TkA05G464810|TK1151|PROTEIN

MAGVSIAAEWQLLGDKYYRKPELYQLRWKNIDLARNKVACAPFGGPIAVIRDESKIVQLYAESALRKLRIFNSAGRQISETVWRNPGGRLIGLSWTDEQVLVCVTQDGTVYRYDIHSKIIEPNVSMGTECFEHSVVECVFWGNGVVCINEAFQLFCIPDLKNPKPSKLADTGLEEFPLCMAVIEPQYTMSGNVEVLLGVGDHVLLVEEDGVQTVGDGLGTLQKMVISHNGKLMASFTHDGQLLVMPTDFSSIIFEYSCES...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G464810`
TK1151 ID	TkA05G464810
OH-1004 ID	LXL04_022399
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G464810

Location Chr05:116457019-116461456 (+)

Description Similar to VCL1: Protein VACUOLELESS1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g38020`	Required for vacuole biogenesis and vacuole enlargment in dividing and expanding cells.	VACUOLELESS1 is an essential gene required for vacuole formation and morphogenesis in Arabidopsis.2001 · DOI: 10.1016/s1534-5807(01)00024-7 Geminating pollen has tubular vacuoles, displays highly dynamic vacuole biogenesis, and requires VACUOLESS1 for proper function.2004 · DOI: 10.1104/pp.103.037382

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022399 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006886 intracellular protein transport Biological Process

GO:0007033 vacuole organization Biological Process

GO:0008333 endosome to lysosome transport Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0016197 endosomal transport Biological Process

GO:0034058 endosomal vesicle fusion Biological Process

GO:0035542 regulation of SNARE complex assembly Biological Process

GO:0042144 vacuole fusion, non-autophagic Biological Process

GO:0045992 negative regulation of embryonic development Biological Process

GO:0046718 symbiont entry into host cell Biological Process

GO:0051469 vesicle fusion with vacuole Biological Process

KEGG gene cross-reference

ath:AT2G38020

bta:505361

ddi:DDB_G0270754

hsa:64601

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.557

Rank 1 · TkA05G464810 · TK1151

Nucleus0.245

Rank 2 · TkA05G464810 · TK1151

Golgi apparatus0.213

Rank 3 · TkA05G464810 · TK1151

Lysosome / Vacuole0.210

Rank 4 · TkA05G464810 · TK1151

Cell membrane0.123

Rank 5 · TkA05G464810 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04841Vps16_N8-407 aa

PF12894ANAPC4_WD4078-142 aa

PF30506Beta-prop_MIP289-139 aa

PF24817WD40_WDHD1_1st98-120 aa

PF30506Beta-prop_MIP2218-254 aa

PF12894ANAPC4_WD40222-269 aa

PF24817WD40_WDHD1_1st224-281 aa

PF04840Vps16_C507-830 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G464810	`PF04841`	Vps16_N	8	407	2.4e-82	277.7
TkA05G464810	`PF12894`	ANAPC4_WD40	78	142	0.004	18.1
TkA05G464810	`PF30506`	Beta-prop_MIP2	89	139	0.11	12.0
TkA05G464810	`PF24817`	WD40_WDHD1_1st	98	120	0.0011	18.9
TkA05G464810	`PF30506`	Beta-prop_MIP2	218	254	0.11	12.0
TkA05G464810	`PF12894`	ANAPC4_WD40	222	269	0.004	18.1
TkA05G464810	`PF24817`	WD40_WDHD1_1st	224	281	0.0011	18.9
TkA05G464810	`PF04840`	Vps16_C	507	830	5.6e-68	230.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93VQ0`	Arabidopsis thaliana	sp\|Q93VQ0\|VCL1_ARATH Protein VACUOLELESS1	73.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card