TkA05G463570 | RubberDandelionOmics

Gene overview

TkA05G463570

Reference: TK1151 Chr: Chr05 Coordinates: 116102914-116106087 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2062 bp · TkA05G463570|TK1151|cDNA

CTCTGCGTCGATTTCGTCATTTGAAACCTCCTAAGATCCACGTTTCTGAACCTCAACGTCAATCAATTGCGGTTTTACGTCAACCAATTGCATCGATGTTTGAATTCTTTTGAACAATCTCTCCATTATTGCAACTATATTCCGTCAAGAACCTTACCGAGAAAAGGTAATGTTCCGGAACTTTGAGCAGTTGGACTTCAAAACTTTACGACTTAGGTCAAACTTGATTCTATATAGAATCAAATCGTAGTGGAGCGACT...

CDS

Download CDS FASTA

1431 bp · TkA05G463570|TK1151|CDS

ATGGTAGAGACTGATTCAAACACCCAAAAAACAGCTCCTGAGGAAGGATTCAGATTCCATAGGGATCCTTCATTCTCTAATTGGGGCGACAAAGATGGGACATACAATCAGAATGACGTACAAGAGGGTGAGATTGCAAATACATCTGAAGCGGATGACAATTTTGAACTGCCAGTGCTTCAAAAAGTTAATGAAGACCAGGGGAATCAGTCTCGGTCAAGGGGTGCAACAATGAATGGAAGTGAGAATAACGACATGTT...

Protein

Download Protein FASTA

476 aa · TkA05G463570|TK1151|PROTEIN

MVETDSNTQKTAPEEGFRFHRDPSFSNWGDKDGTYNQNDVQEGEIANTSEADDNFELPVLQKVNEDQGNQSRSRGATMNGSENNDMFSTNGNYASFSIEDADDRLLDLEDTDFVDNYRDASSSSRNPIAVSDLLKTLFLILMWYIFSTLLTVYNKTLLGDDMGRFPAPLLMNTVHFGMQAVLSRGIIYFWSKRFQRPNISMSQKDYYLRVVPMSLATALDINLSNASLVFISVTFATMCKSASPIFLLIFAFAFRLETPS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G463570`
TK1151 ID	TkA05G463570
OH-1004 ID	LXL04_022366
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G463570

Location Chr05:116102914-116106087 (-)

Description Similar to At1g06470: Probable sugar phosphate/phosphate translocator At1g06470

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g06470`	Probable sugar phosphate/phosphate translocator At1g06470.	No verified direct reference in this release
`At5g11230`	Probable sugar phosphate/phosphate translocator At5g11230.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022366 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010629 negative regulation of gene expression Biological Process

GO:0015780 nucleotide-sugar transmembrane transport Biological Process

GO:0015786 UDP-glucose transmembrane transport Biological Process

GO:0035436 triose phosphate transmembrane transport Biological Process

GO:0036066 protein O-linked glycosylation via fucose Biological Process

GO:0045747 positive regulation of Notch signaling pathway Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005793 endoplasmic reticulum-Golgi intermediate compartment Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005801 cis-Golgi network Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G06470

hsa:51006

mmu:228875

sce:YML038C

spo:2541816

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.619

Rank 1 · TkA05G463570 · TK1151

Endoplasmic reticulum0.172

Rank 2 · TkA05G463570 · TK1151

Cytoplasm0.147

Rank 3 · TkA05G463570 · TK1151

Lysosome / Vacuole0.112

Rank 4 · TkA05G463570 · TK1151

Cell membrane0.058

Rank 5 · TkA05G463570 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03151TPT135-435 aa

PF00892EamA137-278 aa

PF08449UAA171-435 aa

PF16913PUNUT197-440 aa

PF00892EamA287-435 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G463570	`PF03151`	TPT	135	435	2.2e-26	93.6
TkA05G463570	`PF00892`	EamA	137	278	3.8e-10	40.9
TkA05G463570	`PF08449`	UAA	171	435	9.2e-08	32.3
TkA05G463570	`PF16913`	PUNUT	197	440	0.0015	18.5
TkA05G463570	`PF00892`	EamA	287	435	3.8e-10	40.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H184`	Arabidopsis thaliana	sp\|Q8H184\|PT106_ARATH Probable sugar phosphate/phosphate translocator At1g06470	67.400%	Swiss-Prot	High
`Q9LFN3`	Arabidopsis thaliana	sp\|Q9LFN3\|PT511_ARATH Probable sugar phosphate/phosphate translocator At5g11230	27.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card