LXL04_022366 | RubberDandelionOmics

Gene overview

LXL04_022366

Reference: OH-1004 Chr: Chr04 Coordinates: 149264804-149267106 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1455 bp · LXL04_022366|LXL04_022366|OH1004|cDNA

ATGGTAGAGACTGATTCAAACACCCAAAAAACAGCTCCTGAGGAAGGATTCAGATTCCATAGGGATCCTTCATTCTCTAATTGGGGCGACAAAGATGGGACATACAATCAGAATGACGTACAAGAGGGTGAGATTGCAAATACATCTGAAGCGGATGACAATTTTGAACTGCCAGTGCTTCAAAAAGTTAATGAAGACCAGGGGAATCAGTCTCGGTCAAGGGGTGCAACAATGAATGGAAGTGAGAATAACGACATGTT...

CDS

Download CDS FASTA

1455 bp · LXL04_022366|LXL04_022366|OH1004|CDS

ATGGTAGAGACTGATTCAAACACCCAAAAAACAGCTCCTGAGGAAGGATTCAGATTCCATAGGGATCCTTCATTCTCTAATTGGGGCGACAAAGATGGGACATACAATCAGAATGACGTACAAGAGGGTGAGATTGCAAATACATCTGAAGCGGATGACAATTTTGAACTGCCAGTGCTTCAAAAAGTTAATGAAGACCAGGGGAATCAGTCTCGGTCAAGGGGTGCAACAATGAATGGAAGTGAGAATAACGACATGTT...

Protein

Download Protein FASTA

484 aa · LXL04_022366|LXL04_022366|OH1004|PROTEIN

MVETDSNTQKTAPEEGFRFHRDPSFSNWGDKDGTYNQNDVQEGEIANTSEADDNFELPVLQKVNEDQGNQSRSRGATMNGSENNDMFSTNGNYASFSIEDADDRLLDLEDTDFVDNYRDASSSSRNPIAVSDLLKTLFLILMWYIFSTLLTVYNKTLLGDDMGRFPAPLLMNTVHFGMQAVLSRGIIYFWSKRFQRPNISMSQKDYYLRGKWTLPFTVVPMSLATALDINLSNASLVFISVTFATMCKSASPIFLLIFAF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022366`
TK1151 ID	TkA05G463570
OH-1004 ID	LXL04_022366
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022366

Location Chr04:149264804-149267106 (-)

Description Similar to At1g06470: Probable sugar phosphate/phosphate translocator At1g06470

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g06470`	Probable sugar phosphate/phosphate translocator At1g06470.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022366 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0010629 negative regulation of gene expression Biological Process

GO:0015780 nucleotide-sugar transmembrane transport Biological Process

GO:0015786 UDP-glucose transmembrane transport Biological Process

GO:0035436 triose phosphate transmembrane transport Biological Process

GO:0036066 protein O-linked glycosylation via fucose Biological Process

GO:0045747 positive regulation of Notch signaling pathway Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005793 endoplasmic reticulum-Golgi intermediate compartment Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005801 cis-Golgi network Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G06470

hsa:51006

mmu:228875

sce:YML038C

spo:2541816

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.618

Rank 1 · LXL04_022366 · OH-1004

Endoplasmic reticulum0.177

Rank 2 · LXL04_022366 · OH-1004

Cytoplasm0.145

Rank 3 · LXL04_022366 · OH-1004

Lysosome / Vacuole0.105

Rank 4 · LXL04_022366 · OH-1004

Cell membrane0.056

Rank 5 · LXL04_022366 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03151.23TPT135-443 aa

PF00892.27EamA137-286 aa

PF08449.18UAA229-443 aa

PF00892.27EamA295-443 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022366	`PF03151.23`	TPT	135	443	9.5e-24	85.0
LXL04_022366	`PF00892.27`	EamA	137	286	3.2e-09	37.9
LXL04_022366	`PF08449.18`	UAA	229	443	9.1e-08	32.3
LXL04_022366	`PF00892.27`	EamA	295	443	3.2e-09	37.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H184`	Arabidopsis thaliana	Probable sugar phosphate/phosphate translocator At1g06470	60.621%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card