TkA05G461650 | RubberDandelionOmics

Gene overview

TkA05G461650

Reference: TK1151 Chr: Chr05 Coordinates: 115636702-115639386 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

903 bp · TkA05G461650|TK1151|cDNA

ATGTATCCCGCCTCATCCCCAAACTCTCGCAGTCACAACTCACAACTCACGAGACTCACGAGTATCGGCCATCGCCGACTAGTCGACTACCGTTCTTCACCGCACCGATCCCGCCTGTGCCGGCCGGCCAGCGCCTCCGTCAATCCACATTCACCTCCGGCTCCCGCCCAAGCATCCACCTCAGTCGATTTCGCCCTTCGGTTGCAAAACGATTCCCGATTTCCTGCCCAGGATTACTCATTCTTGTATATGGGAAGGTT...

CDS

Download CDS FASTA

903 bp · TkA05G461650|TK1151|CDS

ATGTATCCCGCCTCATCCCCAAACTCTCGCAGTCACAACTCACAACTCACGAGACTCACGAGTATCGGCCATCGCCGACTAGTCGACTACCGTTCTTCACCGCACCGATCCCGCCTGTGCCGGCCGGCCAGCGCCTCCGTCAATCCACATTCACCTCCGGCTCCCGCCCAAGCATCCACCTCAGTCGATTTCGCCCTTCGGTTGCAAAACGATTCCCGATTTCCTGCCCAGGATTACTCATTCTTGTATATGGGAAGGTT...

Protein

Download Protein FASTA

300 aa · TkA05G461650|TK1151|PROTEIN

MYPASSPNSRSHNSQLTRLTSIGHRRLVDYRSSPHRSRLCRPASASVNPHSPPAPAQASTSVDFALRLQNDSRFPAQDYSFLYMGRLLEGFGVGVISYTIPVYIAEIAPQNMRGSLGFVNQFSPFFAICHYWNIVGIPYGAFSPMESTGSYWYFVMHLSDTWSFFFIPESPRWLAKMGFIEDCETSLLVLRGFDSDISSEFNEIKVGIGLLLLQQLSGINGVLFYSSDIFESAGIQSSKAATFGLGAIQLSSVLMAASNL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G461650`
TK1151 ID	TkA05G461650
OH-1004 ID	LXL04_022346
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	55.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G461650

Location Chr05:115636702-115639386 (+)

Description Similar to At1g75220: Sugar transporter ERD6-like 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g75220`	Sugar transporter.	No verified direct reference in this release
`At1g19450`	Sugar transporter.	No verified direct reference in this release
`At1g08930`	Sugar transporter.	No verified direct reference in this release
`At1g08920`	Sugar transporter.	Functional analysis of an Arabidopsis thaliana abiotic stress-inducible facilitated diffusion transporter for monosaccharides.2010 · DOI: 10.1074/jbc.m109.054288
`At1g54730`	Sugar transporter.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022346 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010030 positive regulation of seed germination Biological Process

GO:0015749 monosaccharide transmembrane transport Biological Process

GO:0042593 glucose homeostasis Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005794 Golgi apparatus Cellular Component

KEGG gene cross-reference

ath:AT1G08920

ath:AT1G08930

ath:AT1G19450

ath:AT1G75220

ath:AT3G05400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.332

Rank 1 · TkA05G461650 · TK1151

Cell membrane0.191

Rank 2 · TkA05G461650 · TK1151

Cytoplasm0.160

Rank 3 · TkA05G461650 · TK1151

Nucleus0.145

Rank 4 · TkA05G461650 · TK1151

Lysosome / Vacuole0.127

Rank 5 · TkA05G461650 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00083Sugar_tr78-257 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G461650	`PF00083`	Sugar_tr	78	257	1e-27	97.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FRL3`	Arabidopsis thaliana	sp\|Q9FRL3\|ERDL6_ARATH Sugar transporter ERD6-like 6	56.200%	Swiss-Prot	Medium
`Q93YP9`	Arabidopsis thaliana	sp\|Q93YP9\|ERDL4_ARATH Sugar transporter ERD6-like 4	54.700%	Swiss-Prot	Medium
`O04036`	Arabidopsis thaliana	sp\|O04036\|ERD6_ARATH Sugar transporter ERD6	40.000%	Swiss-Prot	Medium
`Q94KE0`	Arabidopsis thaliana	sp\|Q94KE0\|ESL1_ARATH Sugar transporter ESL1	37.400%	Swiss-Prot	Medium
`Q3ECP7`	Arabidopsis thaliana	sp\|Q3ECP7\|ERDL5_ARATH Sugar transporter ERD6-like 5	38.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card