TkA05G453160 | RubberDandelionOmics

Gene overview

TkA05G453160

Reference: TK1151 Chr: Chr05 Coordinates: 113427318-113428612 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1188 bp · TkA05G453160|TK1151|cDNA

TCGGAAAACACTGTTAAAGTCTCGCCGGACTCAGACTTGGCGTGGCGGCTCATTTTCATGATGGGTGCAATTCCGGCGTCTTTGACTTACTATTGGCAGATGAAGATGCCTGAAACCGCCCGATTCACAGCTTTGATCAAGAATAACCCATTACAAGCAGCCAAAGATATGGAGAAAGTGTTAAATGTATCACTTAGTTTAATCCTAGAAGATATCGAGACTATCAGTAGCCCCATCACTCTTGTTGATTACTCCTATGA...

CDS

Download CDS FASTA

954 bp · TkA05G453160|TK1151|CDS

ATGATGGGTGCAATTCCGGCGTCTTTGACTTACTATTGGCAGATGAAGATGCCTGAAACCGCCCGATTCACAGCTTTGATCAAGAATAACCCATTACAAGCAGCCAAAGATATGGAGAAAGTGTTAAATGTATCACTTAGTTTAATCCTAGAAGATATCGAGACTATCAGTAGCCCCATCACTCTTGTTGATTACTCCTATGATTTATTTTCTATGGAATTTCTCCGGCGACATGGCCGTGATCTCATTGCAGCATCCAT...

Protein

Download Protein FASTA

317 aa · TkA05G453160|TK1151|PROTEIN

MMGAIPASLTYYWQMKMPETARFTALIKNNPLQAAKDMEKVLNVSLSLILEDIETISSPITLVDYSYDLFSMEFLRRHGRDLIAASINRFLLDIVFYSLNLFQYHAFKHHTIAKNYNMDPYGVAMQVAVVQAIIAVCAVIPASFVTVFLIDYVGRVKIQAVGFFSMAICLFIMAKINKVNWGSETSGGFIMLYGLALFFSNCGPNTTTFVVPTELFPARFRATCHGISGGVGKVGAVIGTIGFLWASRDTPHVPDVSNVF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G453160`
TK1151 ID	TkA05G453160
OH-1004 ID	LXL04_022245
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 59.032 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G453160

Location Chr05:113427318-113428612 (-)

Description Similar to PHT1-9: Probable inorganic phosphate transporter 1-9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g76430`	High-affinity transporter for external inorganic phosphate.	No verified direct reference in this release
`At1g20860`	High-affinity transporter for external inorganic phosphate.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0325200`	High-affinity transporter for external inorganic phosphate.	No verified direct reference in this release
`Os10g0444700`	High-affinity transporter for external inorganic phosphate.	No verified direct reference in this release
`Os06g0324800`	High-affinity transporter for external inorganic phosphate.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022245 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006817 phosphate ion transport Biological Process

GO:0009610 response to symbiotic fungus Biological Process

GO:1901684 arsenate ion transmembrane transport Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0005315 phosphate transmembrane transporter activity Molecular Function

GO:0015293 symporter activity Molecular Function

GO:0015415 ATPase-coupled phosphate ion transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G20860

ath:AT1G76430

dosa:Os06g0324800

dosa:Os06g0325200

osa:4340904

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.404

Rank 1 · TkA05G453160 · TK1151

Lysosome / Vacuole0.227

Rank 2 · TkA05G453160 · TK1151

Endoplasmic reticulum0.175

Rank 3 · TkA05G453160 · TK1151

Cytoplasm0.116

Rank 4 · TkA05G453160 · TK1151

Golgi apparatus0.102

Rank 5 · TkA05G453160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00083Sugar_tr3-288 aa

PF07690MFS_1111-283 aa

PF24220DUF7439130-147 aa

PF24709DUF7670137-205 aa

PF24220DUF7439214-266 aa

PF24709DUF7670259-259 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G453160	`PF00083`	Sugar_tr	3	288	1e-24	88.0
TkA05G453160	`PF07690`	MFS_1	111	283	5.9e-06	26.1
TkA05G453160	`PF24220`	DUF7439	130	147	0.31	11.6
TkA05G453160	`PF24709`	DUF7670	137	205	4.5	8.5
TkA05G453160	`PF24220`	DUF7439	214	266	0.31	11.6
TkA05G453160	`PF24709`	DUF7670	259	259	4.5	8.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S735`	Arabidopsis thaliana	sp\|Q9S735\|PHT19_ARATH Probable inorganic phosphate transporter 1-9	53.000%	Swiss-Prot	High
`Q9SYQ1`	Arabidopsis thaliana	sp\|Q9SYQ1\|PHT18_ARATH Probable inorganic phosphate transporter 1-8	50.200%	Swiss-Prot	High
`Q69T94`	Oryza sativa subsp. japonica	sp\|Q69T94\|PT110_ORYSJ Probable inorganic phosphate transporter 1-10	45.000%	Swiss-Prot	Medium
`Q8H6G8`	Oryza sativa subsp. japonica	sp\|Q8H6G8\|PHT18_ORYSJ Probable inorganic phosphate transporter 1-8	45.500%	Swiss-Prot	Medium
`Q8H6G7`	Oryza sativa subsp. japonica	sp\|Q8H6G7\|PHT19_ORYSJ Probable inorganic phosphate transporter 1-9	43.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card