TkA05G452450 | RubberDandelionOmics

Gene overview

TkA05G452450

Reference: TK1151 Chr: Chr05 Coordinates: 113278127-113280722 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

867 bp · TkA05G452450|TK1151|cDNA

ATGTACCGTGGGGTTGGGGAGGGTTGGTATTGGATGGTTTACAAAGGGTGGTTGGACGGTGTAACATCTATTACTGGGGGGGCTGCAGATGGGCTAGCGGTGGCCATCAAGAGAGTCAGGCCCGAGAGCGCTCAAGGTGTCCGACAGTGGCAGGCCGAAATTGATATTTTGGGAACATTTACCCATCCAAATGTTGTTAAACTCTTTGGTTATTGTCGGGAAAAAAATAAGGAGTATCTTCTTGTTTACGAATATATGCA...

CDS

Download CDS FASTA

867 bp · TkA05G452450|TK1151|CDS

ATGTACCGTGGGGTTGGGGAGGGTTGGTATTGGATGGTTTACAAAGGGTGGTTGGACGGTGTAACATCTATTACTGGGGGGGCTGCAGATGGGCTAGCGGTGGCCATCAAGAGAGTCAGGCCCGAGAGCGCTCAAGGTGTCCGACAGTGGCAGGCCGAAATTGATATTTTGGGAACATTTACCCATCCAAATGTTGTTAAACTCTTTGGTTATTGTCGGGAAAAAAATAAGGAGTATCTTCTTGTTTACGAATATATGCA...

Protein

Download Protein FASTA

288 aa · TkA05G452450|TK1151|PROTEIN

MYRGVGEGWYWMVYKGWLDGVTSITGGAADGLAVAIKRVRPESAQGVRQWQAEIDILGTFTHPNVVKLFGYCREKNKEYLLVYEYMQKQSLNMHLFKGGEPVLPWETRINIAMGAAQGLAFLHIPEINIIYGDVKTSNILLDEAFNAKLSYFGLAKVGPDNGDTHVSTSVAGSLCYLAPEYAYTGRLYAKSDVYAFGVVMLEIITGLSIENESRFSREEPLVDWVKPFFTNNKELQKIMDPRLQRVYPLKGAMKAAKLIQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G452450`
TK1151 ID	TkA05G452450
OH-1004 ID	LXL04_022235
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	96.000
Protein coverage (%)	TK1151 100.000 / OH-1004 38.560 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G452450

Location Chr05:113278127-113280722 (+)

Description Similar to PBL4: Probable serine/threonine-protein kinase PBL4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g17220`	May be involved in plant defense signaling.	No verified direct reference in this release
`At1g26970`	May be involved in plant defense signaling.	No verified direct reference in this release
`At4g35600`	Acts as a spatial inhibitor of signaling that modulates abscission zone cell adhesion and expansion.	No verified direct reference in this release
`At2g02800`	May be involved in plant defense signaling.	No verified direct reference in this release
`At5g02290`	May play a role in the regulation of plant growth and development (Probable).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022235 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G26970

ath:AT2G02800

ath:AT2G17220

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.553

Rank 1 · TkA05G452450 · TK1151

Cytoplasm0.338

Rank 2 · TkA05G452450 · TK1151

Nucleus0.211

Rank 3 · TkA05G452450 · TK1151

Endoplasmic reticulum0.055

Rank 4 · TkA05G452450 · TK1151

Golgi apparatus0.039

Rank 5 · TkA05G452450 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr3-280 aa

PF00069Pkinase29-278 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G452450	`PF07714`	PK_Tyr_Ser-Thr	3	280	7.8e-40	137.5
TkA05G452450	`PF00069`	Pkinase	29	278	1.3e-37	130.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SII6`	Arabidopsis thaliana	sp\|Q9SII6\|PIX13_ARATH Probable serine/threonine-protein kinase PIX13	51.200%	Swiss-Prot	High
`Q5PP29`	Arabidopsis thaliana	sp\|Q5PP29\|PBL4_ARATH Probable serine/threonine-protein kinase PBL4	50.900%	Swiss-Prot	High
`P27450`	Arabidopsis thaliana	sp\|P27450\|CST_ARATH Probable serine/threonine-protein kinase CST	48.600%	Swiss-Prot	Medium
`O49840`	Arabidopsis thaliana	sp\|O49840\|PBL3_ARATH Probable serine/threonine-protein kinase PBL3	49.500%	Swiss-Prot	Medium
`P43293`	Arabidopsis thaliana	sp\|P43293\|PBL11_ARATH Probable serine/threonine-protein kinase PBL11	48.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card