LXL04_022235 | RubberDandelionOmics

Gene overview

LXL04_022235

Reference: OH-1004 Chr: Chr04 Coordinates: 146605119-146610648 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2337 bp · LXL04_022235|LXL04_022235|OH1004|cDNA

ATGACAACTTTACCCTTAAGATTtaagaatttttttttcttgCTTCACAAACTGCAATTGCTTACTCAGAGAAGGATGCAGTTTTCCACTGGTCTTATATTACTCCTTCCTGTATTGGGTATTATTTTTCGATATTTACAGAAACATCAGGAGGAAGATGATGGGCAGCAGAATAATTCATCCATGTCATCATCACCGGATCAACAACAATCCTTacacgaagaagaagaagaagaagatggtcAGAGGAAGGATTTATT...

CDS

Download CDS FASTA

2337 bp · LXL04_022235|LXL04_022235|OH1004|CDS

ATGACAACTTTACCCTTAAGATTTAAGAATTTTTTTTTCTTGCTTCACAAACTGCAATTGCTTACTCAGAGAAGGATGCAGTTTTCCACTGGTCTTATATTACTCCTTCCTGTATTGGGTATTATTTTTCGATATTTACAGAAACATCAGGAGGAAGATGATGGGCAGCAGAATAATTCATCCATGTCATCATCACCGGATCAACAACAATCCTTACACGAAGAAGAAGAAGAAGAAGATGGTCAGAGGAAGGATTTATT...

Protein

Download Protein FASTA

778 aa · LXL04_022235|LXL04_022235|OH1004|PROTEIN

MTTLPLRFKNFFFLLHKLQLLTQRRMQFSTGLILLLPVLGIIFRYLQKHQEEDDGQQNNSSMSSSPDQQQSLHEEEEEEDGQRKDLFSSTLQDNQCRHFSLAEIKLATNDFDDVIGKGGFGNVYKGTIDSGEDVAIKRLKLDSSQGAAEFQAEIEMLSQFRHIHIVPLLGYHEGSDEREMILIYKYMSNGSLEDHLHKRRVEGTNSSPLTWVQRLQICIGAARGLDYLHSGTAVESRVIHRDIKSSNILLDENLAAKISD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022235`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022235

Location Chr04:146605119-146610648 (+)

Description Similar to PBL4: Probable serine/threonine-protein kinase PBL4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g26970`	May be involved in plant defense signaling.	No verified direct reference in this release
`At3g51550`	May regulate MLO7 polarization in female gametophyte synergid cells to control pollen tube growth and male gamete delivery during fertilization.	FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development.2010 · DOI: 10.1073/pnas.1005366107
`At2g02800`	May be involved in plant defense signaling.	No verified direct reference in this release
`At2g17220`	May be involved in plant defense signaling.	No verified direct reference in this release
`At4g35600`	Acts as a spatial inhibitor of signaling that modulates abscission zone cell adhesion and expansion.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022235 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G26970

ath:AT2G02800

ath:AT2G17220

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.717

Rank 1 · LXL04_022235 · OH-1004

Cytoplasm0.193

Rank 2 · LXL04_022235 · OH-1004

Nucleus0.149

Rank 3 · LXL04_022235 · OH-1004

Endoplasmic reticulum0.060

Rank 4 · LXL04_022235 · OH-1004

Golgi apparatus0.033

Rank 5 · LXL04_022235 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714.24PK_Tyr_Ser-Thr111-388 aa

PF00069.32Pkinase113-387 aa

PF07714.24PK_Tyr_Ser-Thr480-770 aa

PF00069.32Pkinase507-768 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022235	`PF07714.24`	PK_Tyr_Ser-Thr	111	388	1.2e-84	284.4
LXL04_022235	`PF00069.32`	Pkinase	113	387	7.4e-79	265.6
LXL04_022235	`PF07714.24`	PK_Tyr_Ser-Thr	480	770	1.2e-84	284.4
LXL04_022235	`PF00069.32`	Pkinase	507	768	7.4e-79	265.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q5PP29`	Arabidopsis thaliana	Probable serine/threonine-protein kinase PBL4	50.316%	Swiss-Prot	weak database homology
`Q9SCZ4`	Arabidopsis thaliana	Receptor-like protein kinase FERONIA	49.846%	Swiss-Prot	weak database homology
`O49840`	Arabidopsis thaliana	Probable serine/threonine-protein kinase PBL3	48.348%	Swiss-Prot	weak database homology
`Q9SII6`	Arabidopsis thaliana	Probable serine/threonine-protein kinase PIX13	46.512%	Swiss-Prot	weak database homology
`P27450`	Arabidopsis thaliana	Probable serine/threonine-protein kinase CST	46.440%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card