TkA05G450090 | RubberDandelionOmics

Gene overview

TkA05G450090

Reference: TK1151 Chr: Chr05 Coordinates: 112524521-112530161 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1584 bp · TkA05G450090|TK1151|cDNA

CTTCAGAAAAAACTAAAAAGCTTGGTCCATTTTAATGGCTATACACACGGTCCCGAATCCACCAGGTAGCACTTAGCCAAACCAGGAATCGAACTCCCCCACCACGGGGTATACGGGCTCCAAAACCCCATCAAATATTTCTCTTCCCCTACCGCCGGCTACCCATACCCGCCGCCGACTCTTTCAATCAAGCCGAACGATGAGAAGAGCTTCTACGTTCGCCGCCGCTTCCACGTCCCTATCCCGCGCCATCCTTTCCG...

CDS

Download CDS FASTA

1008 bp · TkA05G450090|TK1151|CDS

ATGAGAAGAGCTTCTACGTTCGCCGCCGCTTCCACGTCCCTATCCCGCGCCATCCTTTCCGAACACCACCACGAATATAACAGGCTCTTTCAGGCAGCATCCTTTTACGCCACTAATGCCGGCTCTTCTCGCCGCTGGTTTTCTTCATCTCTGGGATCTAAACCTCCAGGCAGTTATTCTTCCAGTGCTGCTAAAGTTTTTCTGTCCTTAGGCTGTGTTGCGGCCACCGTCGCGGCTGGGGCGTCATCGGTGTTCGTGGA...

Protein

Download Protein FASTA

335 aa · TkA05G450090|TK1151|PROTEIN

MRRASTFAAASTSLSRAILSEHHHEYNRLFQAASFYATNAGSSRRWFSSSLGSKPPGSYSSSAAKVFLSLGCVAATVAAGASSVFVEEEAYAKEPVSPDLAPKEVVLYQYEACPFCNKVKAFLDYYDVPYKVVEVNPLSKKEIKWSDYKKVPILMVDGQQLQDSSAIIDQMKTKISPVRSSSLVNDDEEEKKWRKWVDDHLVHMLSPNIYRNTSEALESFDYITNNGNFSYTEKYTVKYAGAAAMYFVSKKLKKKYNITD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G450090`
TK1151 ID	TkA05G450090
OH-1004 ID	LXL04_022196
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G450090`
Location	Chr05:112524521-112530161 (-)
Description	Similar to ptges2: Prostaglandin E synthase 2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_022196` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006629 lipid metabolic process Biological Process GO:0045893 positive regulation of DNA-templated transcription Biological Process GO:0046457 prostanoid biosynthetic process Biological Process GO:0046903 secretion Biological Process GO:0000139 Golgi membrane Cellular Component GO:0005576 extracellular region Cellular Component GO:0005634 nucleus Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005829 cytosol Cellular Component GO:0035578 azurophil granule lumen Cellular Component GO:0048471 perinuclear region of cytoplasm Cellular Component GO:0003677 DNA binding Molecular Function
KEGG gene cross-reference	bta:493639 dre:799964 hsa:80142 mmu:96979 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.945

Rank 1 · TkA05G450090 · TK1151

Cytoplasm0.074

Rank 2 · TkA05G450090 · TK1151

Nucleus0.060

Rank 3 · TkA05G450090 · TK1151

Cell membrane0.033

Rank 4 · TkA05G450090 · TK1151

Plastid0.021

Rank 5 · TkA05G450090 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02798GST_N72-100 aa

PF05768Glrx-like104-165 aa

PF00462Glutaredoxin105-159 aa

PF02798GST_N105-168 aa

PF13417GST_N_3107-170 aa

PF13409GST_N_2112-169 aa

PF17172GST_N_4114-205 aa

PF02638GHL10137-225 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G450090	`PF02798`	GST_N	72	100	7.4e-05	23.7
TkA05G450090	`PF05768`	Glrx-like	104	165	0.027	15.5
TkA05G450090	`PF00462`	Glutaredoxin	105	159	3.7e-11	43.8
TkA05G450090	`PF02798`	GST_N	105	168	7.4e-05	23.7
TkA05G450090	`PF13417`	GST_N_3	107	170	3.1e-14	53.8
TkA05G450090	`PF13409`	GST_N_2	112	169	4e-08	34.5
TkA05G450090	`PF17172`	GST_N_4	114	205	1.4e-09	39.2
TkA05G450090	`PF02638`	GHL10	137	225	0.021	14.7
TkA05G450090	`PF05768`	Glrx-like	196	222	0.027	15.5
TkA05G450090	`PF14497`	GST_C_3	206	206	0.0016	19.3
TkA05G450090	`PF17172`	GST_N_4	245	274	1.4e-09	39.2
TkA05G450090	`PF14497`	GST_C_3	252	325	0.0016	19.3
TkA05G450090	`PF00043`	GST_C	253	325	0.00041	21.3
TkA05G450090	`PF13410`	GST_C_2	261	322	4.9e-06	27.3
TkA05G450090	`PF22041`	GST_C_7	265	319	0.0093	16.6
TkA05G450090	`PF17171`	GST_C_6	276	305	0.037	14.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card