RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA05G449420
Reference: TK1151 Chr: Chr05 Coordinates: 112374054-112377958 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

720 bp · TkA05G449420|TK1151|cDNA

TTGGGTCAAATACATTTAATGATTGCAAGATTTAGTTTGTATAGTTCAAAGTTGTTCATGCAATAATGACTGCATCCTTGGAGATTACAGCCTCCGAGTTCTTACAAGGTTCAAGGACTCGTAACTTCTTCTTGCCAAAACCTTTACACAAAAGAAACAATTTGGTGAGAATATGCAACCAAGAAAGTCAAGGCCGTGGTATCGGTAGACACACAGGATTTGGGCAGTGTCGACAAAGCCGAAAGCGAAAAAGTGATTCA...

CDS

Download CDS FASTA

327 bp · TkA05G449420|TK1151|CDS

ATGACTGCATCCTTGGAGATTACAGCCTCCGAGTTCTTACAAGGTTCAAGGACTCGTAACTTCTTCTTGCCAAAACCTTTACACAAAAGAAACAATTTGGTGAGAATATGCAACCAAGAAAGTCAAGGCCGTGGTATCGGTAGACACACAGGATTTGGGCAGTGTCGACAAAGCCGAAAGCGAAAAAGTGATTCACTTCTACAGAACTCCCCTGATTCAAGAAACAGCAAACGAAGAATTACTGAAAACAAAAATCTCAA...

Protein

Download Protein FASTA

108 aa · TkA05G449420|TK1151|PROTEIN

MTASLEITASEFLQGSRTRNFFLPKPLHKRNNLVRICNQESQGRGIGRHTGFGQCRQSRKRKSDSLLQNSPDSRNSKRRITENKNLKPNCGFENRTMLQYWCRRELII

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA05G449420
TK1151 IDTkA05G449420
OH-1004 IDLXL04_029930
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)69.800
Protein coverage (%)TK1151 36.111 / OH-1004 3.797
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA05G449420
LocationChr05:112374054-112377958 (-)
DescriptionSimilar to At1g74260: Probable phosphoribosylformylglycinamidine synthase, chloroplastic/mitochondrial
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_029930 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006164 purine nucleotide biosynthetic process Biological Process
GO:0006177 GMP biosynthetic process Biological Process
GO:0006189 'de novo' IMP biosynthetic process Biological Process
GO:0006541 glutamine metabolic process Biological Process
GO:0009113 purine nucleobase biosynthetic process Biological Process
GO:0009168 purine ribonucleoside monophosphate biosynthetic process Biological Process
GO:0009410 response to xenobiotic stimulus Biological Process
GO:0009555 pollen development Biological Process
GO:0044208 'de novo' AMP biosynthetic process Biological Process
GO:0055046 microgametogenesis Biological Process
GO:0097294 'de novo' XMP biosynthetic process Biological Process
GO:0005737 cytoplasm Cellular Component
KEGG gene cross-reference
ath:AT1G74260
ddi:DDB_G0288145
dme:Dmel_CG9127
hsa:5198
mmu:237823
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.788
Rank 1 · TkA05G449420 · TK1151
Cytoplasm0.230
Rank 2 · TkA05G449420 · TK1151
Mitochondrion0.062
Rank 3 · TkA05G449420 · TK1151
Cell membrane0.025
Rank 4 · TkA05G449420 · TK1151
Endoplasmic reticulum0.013
Rank 5 · TkA05G449420 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser