TkA05G448430 | RubberDandelionOmics

Gene overview

TkA05G448430

Reference: TK1151 Chr: Chr05 Coordinates: 112093691-112094869 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1179 bp · TkA05G448430|TK1151|cDNA

ATGGCTTCCGTCTCTTTCTTTCTTCCAATCATGATAGCATTTATCATCTTCTTCTTCTTCGTCTGCGTTGAATCAATTGAAGACAAGAAAACCAACGATGGAGCTGTTATTAATGTTACAAAACACTTCTCTTTCACTGATTTCAATACCCCAAGAACTGTTCATGATATCATGCTGCTGGGGAGCTCCGTCGTGGATAAAACCGGTCGAATTCAAATACCTGACACCACCCAGAACGACGTCGTCGATCTGAAGCACTT...

CDS

Download CDS FASTA

1179 bp · TkA05G448430|TK1151|CDS

ATGGCTTCCGTCTCTTTCTTTCTTCCAATCATGATAGCATTTATCATCTTCTTCTTCTTCGTCTGCGTTGAATCAATTGAAGACAAGAAAACCAACGATGGAGCTGTTATTAATGTTACAAAACACTTCTCTTTCACTGATTTCAATACCCCAAGAACTGTTCATGATATCATGCTGCTGGGGAGCTCCGTCGTGGATAAAACCGGTCGAATTCAAATACCTGACACCACCCAGAACGACGTCGTCGATCTGAAGCACTT...

Protein

Download Protein FASTA

392 aa · TkA05G448430|TK1151|PROTEIN

MASVSFFLPIMIAFIIFFFFVCVESIEDKKTNDGAVINVTKHFSFTDFNTPRTVHDIMLLGSSVVDKTGRIQIPDTTQNDVVDLKHLVGRAVYAYPVRVFDPVTRTPASFETTFAFQIETTKTNESSGGGGGDGGGDGGSGFTLMITPDEFTVGRPGPWLGMLNDACDEQYKAVGIEFDTRENIQFGDPNDNHLGINLGSIVSTITVNVSEFGINLKDGEIHRAWVHYNSQNRFLDIRLDSDSRGYPSKLVFSGELDISE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G448430`
TK1151 ID	TkA05G448430
OH-1004 ID	LXL04_022158
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 57.310 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G448430

Location Chr05:112093691-112094869 (+)

Description Similar to LECRK82: L-type lectin-domain containing receptor kinase VIII.2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g55830`	Involved in resistance response to the pathogenic oomycetes Phytophthora infestans and Phytophthora capsici.	No verified direct reference in this release
`At3g55550`	Involved in resistance response to the pathogenic oomycetes Phytophthora infestans and Phytophthora capsici and to the pathogenic bacteria Pseudomonas syringae.	No verified direct reference in this release
`At5g06740`	Probable L-type lectin-domain containing receptor kinase S.5.	No verified direct reference in this release
`At1g70110`	Putative L-type lectin-domain containing receptor kinase V.1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022158 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002229 defense response to oomycetes Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004675 transmembrane receptor protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0030246 carbohydrate binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT3G53380

ath:AT3G55550

ath:AT5G03140

ath:AT5G06740

ath:AT5G55830

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.618

Rank 1 · TkA05G448430 · TK1151

Endoplasmic reticulum0.140

Rank 2 · TkA05G448430 · TK1151

Cytoplasm0.099

Rank 3 · TkA05G448430 · TK1151

Lysosome / Vacuole0.092

Rank 4 · TkA05G448430 · TK1151

Extracellular0.078

Rank 5 · TkA05G448430 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05814Ac765-29 aa

PF06422PDR_CDR10-28 aa

PF25184YxzE10-31 aa

PF00139Lectin_legB41-295 aa

PF18483Lectin_L-type_dom109-282 aa

PF05268GP38112-141 aa

PF25184YxzE124-141 aa

PF05268GP38309-319 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G448430	`PF05814`	Ac76	5	29	0.05	14.3
TkA05G448430	`PF06422`	PDR_CDR	10	28	1.3	9.6
TkA05G448430	`PF25184`	YxzE	10	31	5.0	8.9
TkA05G448430	`PF00139`	Lectin_legB	41	295	1.7e-53	182.4
TkA05G448430	`PF18483`	Lectin_L-type_dom	109	282	2.2e-10	41.5
TkA05G448430	`PF05268`	GP38	112	141	0.14	13.0
TkA05G448430	`PF25184`	YxzE	124	141	5.0	8.9
TkA05G448430	`PF05268`	GP38	309	319	0.14	13.0
TkA05G448430	`PF25184`	YxzE	312	318	5.0	8.9
TkA05G448430	`PF05814`	Ac76	321	350	0.05	14.3
TkA05G448430	`PF25184`	YxzE	325	350	5.0	8.9
TkA05G448430	`PF06422`	PDR_CDR	327	355	1.3	9.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FHG4`	Arabidopsis thaliana	sp\|Q9FHG4\|LRKS7_ARATH Probable L-type lectin-domain containing receptor kinase S.7	30.900%	Swiss-Prot	Medium
`Q9M2S4`	Arabidopsis thaliana	sp\|Q9M2S4\|LRKS4_ARATH L-type lectin-domain containing receptor kinase S.4	31.300%	Swiss-Prot	Medium
`Q9FG33`	Arabidopsis thaliana	sp\|Q9FG33\|LRKS5_ARATH Probable L-type lectin-domain containing receptor kinase S.5	30.800%	Swiss-Prot	Medium
`O04534`	Arabidopsis thaliana	sp\|O04534\|LRK51_ARATH Putative L-type lectin-domain containing receptor kinase V.1	25.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card