TkA05G447730 | RubberDandelionOmics

Gene overview

TkA05G447730

Reference: TK1151 Chr: Chr05 Coordinates: 111965852-111971133 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3635 bp · TkA05G447730|TK1151|cDNA

TTGAAATTACCCCCTCAAGCGTGGGGGAATATTCCCAAAATAAACAAAAAACAAAGAGGTCGCTTATGGAGTAAATGCTTCAACTCTGCCTAGGGCATCTTCAACCCCTTCGCCATTGGCGATAAGCGTAACTCCATACTCATCGCTCTCATTCATTTCTCAATACGCCTCTCATTCCACTCTCCATTCAGCCCTTCAATCGGAATTTTTGAAACATAGATAGCTTTAAATCTGACGAAAAATAATAAAATTAAAACTTG...

CDS

Download CDS FASTA

2970 bp · TkA05G447730|TK1151|CDS

ATGGCAGACTCAAGGGTCGATGTCATACTTGAATTCCTCAAAAGGAATAACTTTTCTAGAGCTGAAGCAGCATTGCGAAGTGAGATTGATAACAGGCCTGATTTGAATGGGTTTATGCAAGATCTCAACATTGGAGAAAAGGATTTGTTAGAAAATGAGAAGACCACAAAACCTGTTGCATCTGGAAACAGAGAAAAAAGTTCTTCAACAAGTGATGAAGCTTCAAAAGAGGAGCATATTGTGAAAGAGGTAGAATTTGG...

Protein

Download Protein FASTA

989 aa · TkA05G447730|TK1151|PROTEIN

MADSRVDVILEFLKRNNFSRAEAALRSEIDNRPDLNGFMQDLNIGEKDLLENEKTTKPVASGNREKSSSTSDEASKEEHIVKEVEFGTKRNGPDSKWEIGSFEGDQNSEQLEAKNKNFVFSNGSDDNLLDLYTWRFNPSNGYDDDDDDDNDNDGHGIRAESVKEYQVSSLSKIHPSESSNTDGKVSFLGPVSTKTDLIPKQQIMDKLVDPKGQFSQKDGFVDNPWSRNDEFNCSIKTVFPFPEGDASTSYGVGEKEDGKR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G447730`
TK1151 ID	TkA05G447730
OH-1004 ID	LXL04_022151
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.900
Protein coverage (%)	TK1151 100.000 / OH-1004 97.350 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G447730`
Location	Chr05:111965852-111971133 (-)
Description	Similar to DYRK4: Dual specificity tyrosine-phosphorylation-regulated kinase 4
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_022151` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006468 protein phosphorylation Biological Process GO:0007224 smoothened signaling pathway Biological Process GO:0010972 negative regulation of G2/M transition of mitotic cell cycle Biological Process GO:0018108 peptidyl-tyrosine phosphorylation Biological Process GO:0023052 signaling Biological Process GO:0030950 establishment or maintenance of actin cytoskeleton polarity Biological Process GO:0031569 mitotic G2 cell size control checkpoint signaling Biological Process GO:0032878 regulation of establishment or maintenance of cell polarity Biological Process GO:0032956 regulation of actin cytoskeleton organization Biological Process GO:0045725 positive regulation of glycogen biosynthetic process Biological Process GO:0051519 activation of bipolar cell growth Biological Process GO:0061245 establishment or maintenance of bipolar cell polarity Biological Process
KEGG gene cross-reference	ddi:DDB_G0293750 hsa:8798 mmu:69181 spo:2541889 spo:2542228 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.598

Rank 1 · TkA05G447730 · TK1151

Cytoplasm0.386

Rank 2 · TkA05G447730 · TK1151

Cell membrane0.064

Rank 3 · TkA05G447730 · TK1151

Endoplasmic reticulum0.038

Rank 4 · TkA05G447730 · TK1151

Golgi apparatus0.037

Rank 5 · TkA05G447730 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12630Pox_polyA_pol_N1-42 aa

PF24951LisH_PAC19-31 aa

PF00069Pkinase678-980 aa

PF12630Pox_polyA_pol_N679-758 aa

PF07714PK_Tyr_Ser-Thr680-885 aa

PF03109ABC1685-712 aa

PF03109ABC1800-834 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G447730	`PF12630`	Pox_polyA_pol_N	1	42	0.3	12.1
TkA05G447730	`PF24951`	LisH_PAC1	9	31	0.097	13.1
TkA05G447730	`PF00069`	Pkinase	678	980	1e-50	173.4
TkA05G447730	`PF12630`	Pox_polyA_pol_N	679	758	0.3	12.1
TkA05G447730	`PF07714`	PK_Tyr_Ser-Thr	680	885	1.9e-17	64.1
TkA05G447730	`PF03109`	ABC1	685	712	0.038	13.9
TkA05G447730	`PF03109`	ABC1	800	834	0.038	13.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card