Gene Card
Gene overview
cDNA / CDS / Protein Sequences
3060 bp · LXL04_022151|LXL04_022151|OH1004|cDNA
ATGTGGAAGTTGAAATTACCCCCTCAAGCGTGGGGGAATATTCCcaaaataaacaaaaaacaaaGAGGATTTAGTTCGAATATGGCAGACTCAAGGGTCGATGTCATACTTGAATTCCTCAAAAGGAATAACTTTTCTAGAGCTGAAGCAGCATTGCGAAGTGAGATTGATAACAGGCCTGATTTGAATGGGTTTATGCAAGATCTCAACATTGGAGAAAAGGATTTGTTAGAAAATGAGAAGACCACAAAACCTGTTGC...
3060 bp · LXL04_022151|LXL04_022151|OH1004|CDS
ATGTGGAAGTTGAAATTACCCCCTCAAGCGTGGGGGAATATTCCCAAAATAAACAAAAAACAAAGAGGATTTAGTTCGAATATGGCAGACTCAAGGGTCGATGTCATACTTGAATTCCTCAAAAGGAATAACTTTTCTAGAGCTGAAGCAGCATTGCGAAGTGAGATTGATAACAGGCCTGATTTGAATGGGTTTATGCAAGATCTCAACATTGGAGAAAAGGATTTGTTAGAAAATGAGAAGACCACAAAACCTGTTGC...
Protein
Download Protein FASTA1019 aa · LXL04_022151|LXL04_022151|OH1004|PROTEIN
MWKLKLPPQAWGNIPKINKKQRGFSSNMADSRVDVILEFLKRNNFSRAEAALRSEIDNRPDLNGFMQDLNIGEKDLLENEKTTKPVASGNREKSSSTSDEASKEEHIVKEVEFGTKRNGPDSKWEIGSFEGDQNSEQLEAKNKNFVFSNGSDDNLLDLYTWRFNPSNGYDDDDDDDDNDNDGHGIRAESVKEYQVSSLSKIHPSESSNTDGKVSFLGPVSTKTDLIPKQQIMDKLVDPKGQFSQKDGFVDNPWSRNDEFN...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_022151 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_022151 |
|---|---|
| Location | Chr04:145372427-145377459 (-) |
| Description | Similar to DYRK4: Dual specificity tyrosine-phosphorylation-regulated kinase 4 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006468 protein phosphorylation Biological Process GO:0007224 smoothened signaling pathway Biological Process GO:0010972 negative regulation of G2/M transition of mitotic cell cycle Biological Process GO:0018108 peptidyl-tyrosine phosphorylation Biological Process GO:0023052 signaling Biological Process GO:0030950 establishment or maintenance of actin cytoskeleton polarity Biological Process GO:0031569 mitotic G2 cell size control checkpoint signaling Biological Process GO:0032878 regulation of establishment or maintenance of cell polarity Biological Process GO:0032956 regulation of actin cytoskeleton organization Biological Process GO:0045725 positive regulation of glycogen biosynthetic process Biological Process GO:0051519 activation of bipolar cell growth Biological Process GO:0061245 establishment or maintenance of bipolar cell polarity Biological Process |
| KEGG gene cross-reference | ddi:DDB_G0293750 hsa:8798 mmu:69181 spo:2541889 spo:2542228 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00069.32Pkinase708-1010 aaPF07714.24PK_Tyr_Ser-Thr710-915 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_022151 | PF00069.32 | Pkinase | 708 | 1010 | 1e-50 | 173.3 |
| LXL04_022151 | PF07714.24 | PK_Tyr_Ser-Thr | 710 | 915 | 2.1e-17 | 64.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.