TkA05G447260 | RubberDandelionOmics

Gene overview

TkA05G447260

Reference: TK1151 Chr: Chr05 Coordinates: 111837961-111840401 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1403 bp · TkA05G447260|TK1151|cDNA

TATAAGTTCACTTACATTCGAAAAATTCGGATAACATAAAGCTCAAAAATTATTTTGTTCCATTGCAATGAAAAAGCAAGCATTTATGGTGTTCTTTTGCCTCTACATGAGCGCCATAGCTGTCGGAAATTCCGCTGAGAGATTTTCAGTTAGCTATGGTGGGCGGCATCACGGGCGGCAAAAGTTGAAAGTGTTTGTGTTTGGAGACTCGTATGCGGATACTGGAAACTGGCCAAAATCATACGGCGGTGCATGGGGGA...

CDS

Download CDS FASTA

1068 bp · TkA05G447260|TK1151|CDS

ATGAAAAAGCAAGCATTTATGGTGTTCTTTTGCCTCTACATGAGCGCCATAGCTGTCGGAAATTCCGCTGAGAGATTTTCAGTTAGCTATGGTGGGCGGCATCACGGGCGGCAAAAGTTGAAAGTGTTTGTGTTTGGAGACTCGTATGCGGATACTGGAAACTGGCCAAAATCATACGGCGGTGCATGGGGGAAACCGTATGGTTTGACTTTTCCTGGTAGTCCTTCCGGCAGGTTTTCCGATGGCCGTGTACTCACTGA...

Protein

Download Protein FASTA

355 aa · TkA05G447260|TK1151|PROTEIN

MKKQAFMVFFCLYMSAIAVGNSAERFSVSYGGRHHGRQKLKVFVFGDSYADTGNWPKSYGGAWGKPYGLTFPGSPSGRFSDGRVLTDYIAAILGAKCPITYRGWKSGEKKSIKYGMNFAYGGTGVFSTFVNQPNMTTQIDYFQQFLQETQEQHLLNSSTNSIALLSVAGNDYATYFTSNHTLQELPGLTKSIINQLIINAKRIHELGVQKIGITTMQPLGCLPQFTVSTSYQNCSNTENSVAELHNKVLVESVLKLNNES...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G447260`
TK1151 ID	TkA05G447260
OH-1004 ID	LXL04_022140
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G447260

Location Chr05:111837961-111840401 (-)

Description Similar to At5g03610: GDSL esterase/lipase At5g03610

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g03610`	GDSL esterase/lipase At5g03610.	No verified direct reference in this release
`At3g09930`	GDSL esterase/lipase At3g09930.	No verified direct reference in this release
`At2g36325`	GDSL esterase/lipase At2g36325.	No verified direct reference in this release
`At5g03600`	GDSL esterase/lipase At5g03600.	No verified direct reference in this release
`At5g03590`	GDSL esterase/lipase At5g03590.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022140 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016042 lipid catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0099503 secretory vesicle Cellular Component

GO:0016788 hydrolase activity, acting on ester bonds Molecular Function

KEGG gene cross-reference

ath:AT2G36325

ath:AT3G09930

ath:AT5G03590

ath:AT5G03600

ath:AT5G03610

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.478

Rank 1 · TkA05G447260 · TK1151

Cell membrane0.161

Rank 2 · TkA05G447260 · TK1151

Endoplasmic reticulum0.122

Rank 3 · TkA05G447260 · TK1151

Cytoplasm0.101

Rank 4 · TkA05G447260 · TK1151

Lysosome / Vacuole0.094

Rank 5 · TkA05G447260 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00657Lipase_GDSL42-344 aa

PF03991Prion_octapep52-68 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G447260	`PF00657`	Lipase_GDSL	42	344	3.2e-27	96.8
TkA05G447260	`PF03991`	Prion_octapep	52	68	0.015	16.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LZS7`	Arabidopsis thaliana	sp\|Q9LZS7\|GDL71_ARATH GDSL esterase/lipase At5g03610	47.600%	Swiss-Prot	Medium
`Q9SF94`	Arabidopsis thaliana	sp\|Q9SF94\|GDL50_ARATH GDSL esterase/lipase At3g09930	50.000%	Swiss-Prot	High
`Q8RWJ4`	Arabidopsis thaliana	sp\|Q8RWJ4\|GDL45_ARATH GDSL esterase/lipase At2g36325	40.200%	Swiss-Prot	Medium
`Q9LZS8`	Arabidopsis thaliana	sp\|Q9LZS8\|GDL70_ARATH GDSL esterase/lipase At5g03600	35.500%	Swiss-Prot	Medium
`Q9LZS9`	Arabidopsis thaliana	sp\|Q9LZS9\|GDL69_ARATH GDSL esterase/lipase At5g03590	37.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card