TkA05G445830 | RubberDandelionOmics

Gene overview

TkA05G445830

Reference: TK1151 Chr: Chr05 Coordinates: 111525323-111525742 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

315 bp · TkA05G445830|TK1151|cDNA

ATGGCACCAAAGGCTGAGAAGAAACCGGCAGAGAAGAAACCAGCGGCGGAGAAGGCTCCGGCAGAGAAGAAACCGAAGGCGGAGAAGAAGCTACCGAAAATCTCAAGCAAGGCTATGGGGATTATGAATTCGTTCATCAACGATATATTTGAGAAATTGGCGCAGGAATCTTCAAAACTCGCGAGGTATAACAAGAAGCCTACTATCACTTCTAGGGAAATTCAGACCGCTGTTAGACTTGTTCTTCCTGGTGAATTGGC...

CDS

Download CDS FASTA

315 bp · TkA05G445830|TK1151|CDS

ATGGCACCAAAGGCTGAGAAGAAACCGGCAGAGAAGAAACCAGCGGCGGAGAAGGCTCCGGCAGAGAAGAAACCGAAGGCGGAGAAGAAGCTACCGAAAATCTCAAGCAAGGCTATGGGGATTATGAATTCGTTCATCAACGATATATTTGAGAAATTGGCGCAGGAATCTTCAAAACTCGCGAGGTATAACAAGAAGCCTACTATCACTTCTAGGGAAATTCAGACCGCTGTTAGACTTGTTCTTCCTGGTGAATTGGC...

Protein

Download Protein FASTA

104 aa · TkA05G445830|TK1151|PROTEIN

MAPKAEKKPAEKKPAAEKAPAEKKPKAEKKLPKISSKAMGIMNSFINDIFEKLAQESSKLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G445830`
TK1151 ID	TkA05G445830
OH-1004 ID	LXL04_022111
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	74.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G445830

Location Chr05:111525323-111525742 (+)

Description Similar to H2B-3: Histone H2B.3 (Fragment)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g02570`	Core component of nucleosome.	No verified direct reference in this release
`At1g07790`	Core component of nucleosome.	No verified direct reference in this release
`At2g37470`	Core component of nucleosome.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022111 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006325 chromatin organization Biological Process

GO:0000786 nucleosome Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0030527 structural constituent of chromatin Molecular Function

GO:0046982 protein heterodimerization activity Molecular Function

KEGG gene cross-reference

ath:AT2G37470

ath:AT3G45980

mtr:11417139

mtr:11442767

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.888

Rank 1 · TkA05G445830 · TK1151

Cytoplasm0.135

Rank 2 · TkA05G445830 · TK1151

Extracellular0.056

Rank 3 · TkA05G445830 · TK1151

Mitochondrion0.021

Rank 4 · TkA05G445830 · TK1151

Cell membrane0.017

Rank 5 · TkA05G445830 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17671DUF55314-60 aa

PF29070MSC6_N14-94 aa

PF01873eIF-5_eIF-2B24-92 aa

PF26281Histone_ABTB26-102 aa

PF00808CBFD_NFYB_HMF29-78 aa

PF00125Histone33-80 aa

PF03847TFIID_20kDa39-76 aa

PF17671DUF553158-100 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G445830	`PF17671`	DUF5531	4	60	0.47	11.1
TkA05G445830	`PF29070`	MSC6_N	14	94	0.028	14.2
TkA05G445830	`PF01873`	eIF-5_eIF-2B	24	92	0.25	11.9
TkA05G445830	`PF26281`	Histone_ABTB	26	102	1.1e-07	32.2
TkA05G445830	`PF00808`	CBFD_NFYB_HMF	29	78	0.0017	19.3
TkA05G445830	`PF00125`	Histone	33	80	6.9e-13	49.5
TkA05G445830	`PF03847`	TFIID_20kDa	39	76	0.11	13.7
TkA05G445830	`PF17671`	DUF5531	58	100	0.47	11.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LZ45`	Arabidopsis thaliana	sp\|Q9LZ45\|H2B9_ARATH Histone H2B.9	66.400%	Swiss-Prot	High
`Q9LQQ4`	Arabidopsis thaliana	sp\|Q9LQQ4\|H2B1_ARATH Histone H2B.1	100.000%	Swiss-Prot	Medium
`Q9ZUS0`	Arabidopsis thaliana	sp\|Q9ZUS0\|H2B4_ARATH Histone H2B.4	98.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card