Gene Card
Gene overview
cDNA / CDS / Protein Sequences
732 bp · TkA05G443010|TK1151|cDNA
ATGGCCGCCGCAGCACCACCACCACTGCCGACCACCACACCGGAACTCAACATGGATCTCCCGAACAACTACCCACTCTTCACCAGGATCCGCCTGGCCACCAGAACCGACGTCCCTGTCATCCACAAAATGATCTACCAAATGGCCGTATTCGAACGCCTCGCCAACGAATGCTCCGCCACCGAACCTTCCCTTGCCACTACCCTCTTCTCCAAAGACAACCCCTTCGAATCCTTCACCGTGTTCCTAATCGAAGCTTC...
732 bp · TkA05G443010|TK1151|CDS
ATGGCCGCCGCAGCACCACCACCACTGCCGACCACCACACCGGAACTCAACATGGATCTCCCGAACAACTACCCACTCTTCACCAGGATCCGCCTGGCCACCAGAACCGACGTCCCTGTCATCCACAAAATGATCTACCAAATGGCCGTATTCGAACGCCTCGCCAACGAATGCTCCGCCACCGAACCTTCCCTTGCCACTACCCTCTTCTCCAAAGACAACCCCTTCGAATCCTTCACCGTGTTCCTAATCGAAGCTTC...
Protein
Download Protein FASTA243 aa · TkA05G443010|TK1151|PROTEIN
MAAAAPPPLPTTTPELNMDLPNNYPLFTRIRLATRTDVPVIHKMIYQMAVFERLANECSATEPSLATTLFSKDNPFESFTVFLIEASTKPFPPSSIGHHPKFTPIHKTLNLDYPISDPESEVFKSSTMEDGVIVAGFVLFFPNYSTFLAKPGFYIEDLFVRESYRRKGLGKMLLSAVARQAVAMGYGRVEWVVLDWNTNAIKFYEEMGANVMKEWRESERWIRVFWWWYNVNCLISPFPDVKT
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA05G443010 |
|---|---|
| TK1151 ID | TkA05G443010 |
| OH-1004 ID | LXL04_022050 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.600 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA05G443010 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr05:110683561-110684406 (-) | |||||||||
| Description | Similar to At2g39020: Probable acetyltransferase NATA1-like | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006591 ornithine metabolic process Biological Process GO:0006952 defense response Biological Process GO:0009447 putrescine catabolic process Biological Process GO:0009753 response to jasmonic acid Biological Process GO:0070458 cellular detoxification of nitrogen compound Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0004145 diamine N-acetyltransferase activity Molecular Function GO:0004596 protein-N-terminal amino-acid acetyltransferase activity Molecular Function GO:0008080 N-acetyltransferase activity Molecular Function GO:0050366 tyramine N-feruloyltransferase activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT2G39020 ath:AT2G39030 nta:107789681 nta:107822189 spo:2543272 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF13302Acetyltransf_330-84 aaPF00583Acetyltransf_1115-208 aaPF13508Acetyltransf_7130-208 aaPF13673Acetyltransf_10134-213 aaPF08445FR47148-212 aaPF17013Acetyltransf_15150-180 aaPF14542Acetyltransf_CG154-186 aaPF12568PanZ155-182 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA05G443010 | PF13302 | Acetyltransf_3 | 30 | 84 | 0.0081 | 17.6 |
| TkA05G443010 | PF00583 | Acetyltransf_1 | 115 | 208 | 1.2e-18 | 68.2 |
| TkA05G443010 | PF13508 | Acetyltransf_7 | 130 | 208 | 1.1e-10 | 42.4 |
| TkA05G443010 | PF13673 | Acetyltransf_10 | 134 | 213 | 2.5e-08 | 34.7 |
| TkA05G443010 | PF08445 | FR47 | 148 | 212 | 1.7e-07 | 31.8 |
| TkA05G443010 | PF17013 | Acetyltransf_15 | 150 | 180 | 0.31 | 11.1 |
| TkA05G443010 | PF14542 | Acetyltransf_CG | 154 | 186 | 0.07 | 14.0 |
| TkA05G443010 | PF12568 | PanZ | 155 | 182 | 0.007 | 16.6 |
| TkA05G443010 | PF13880 | Acetyltransf_13 | 155 | 183 | 0.041 | 14.4 |
| TkA05G443010 | PF13302 | Acetyltransf_3 | 159 | 209 | 0.0081 | 17.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.