TkA05G442780 | RubberDandelionOmics

Gene overview

TkA05G442780

Reference: TK1151 Chr: Chr05 Coordinates: 110587821-110592540 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2397 bp · TkA05G442780|TK1151|cDNA

TATTGTAAACCTGAGGGTCTTGGGATGTAACTTACATTCTCACCTGAAGTCAGCCAATTGACCCAATCCTAAGACGCTAACACCTTAAATGTTCGATTTTCGTTTTGTAAATGTAAAACATTGACAGTTGGAACTTAGAAGGCAACACAGAAGTCCCCTCACCCCTTCACACAAAACACACACACACACACACACACCATCCCGTCGTTTTCCGAGGTTTCAATTCTCTGTGTGCGTGCATATATAGACTTCCGAAATCA...

CDS

Download CDS FASTA

1653 bp · TkA05G442780|TK1151|CDS

ATGGGGTTTATCGGCGTTTTTTTGGGAATCGTTGGGGTCGGAATCGGGATTGTTGTTGGTCTTTGCCTTGGGTTTTACTTCTTCATCTATTCCGACCCCAAAAACGAACCATTCGAGGATCCTATCGTCAAGCCAATTTCCGAACTTGATACAACTAGTCTACAAGATTTATTACCCGAGATACCTCTATGGTTAAAGAATCCTGATTACGATCGTGTCGACTGGCTTAACGCATTTGTTTTAAATATGTGGCCTTATCT...

Protein

Download Protein FASTA

550 aa · TkA05G442780|TK1151|PROTEIN

MGFIGVFLGIVGVGIGIVVGLCLGFYFFIYSDPKNEPFEDPIVKPISELDTTSLQDLLPEIPLWLKNPDYDRVDWLNAFVLNMWPYLDKAICAAIRQSTEPIVADYVGQGHRPIESITFETLSLGTLPPIFQGIKVYETNENQLVMEPAIKWAGNPNIVIAVKISYFRIKIQLVDLQAFVLPRVTLKPLVSAFPCFANVVVSLLEKPHVDFGLKVLGGDIMAIPGLDRLVQEIIKKEVAKLYLWPQTLQIPILDSSLCVV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G442780`
TK1151 ID	TkA05G442780
OH-1004 ID	LXL04_022045
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G442780

Location Chr05:110587821-110592540 (-)

Description Similar to SYT3: Synaptotagmin-3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g04220`	May be involved in membrane trafficking.	No verified direct reference in this release
`At1g20080`	May play an important role in regulating an unconventional protein trafficking from the cytosol to the extracellular matrix.	Golgi apparatus-localized synaptotagmin 2 is required for unconventional secretion in Arabidopsis.2011 · DOI: 10.1371/journal.pone.0026477
`At2g20990`	Plays an important role in maintaining plasma membrane integrity during freezing and osmotic stresses.	Arabidopsis synaptotagmin 1 is required for the maintenance of plasma membrane integrity and cell viability.2008 · DOI: 10.1105/tpc.108.063859 Calcium-dependent freezing tolerance in Arabidopsis involves membrane resealing via synaptotagmin SYT1.2008 · DOI: 10.1105/tpc.108.062679 Arabidopsis synaptotagmin SYTA regulates endocytosis and virus movement protein cell-to-cell transport.2010 · DOI: 10.1073/pnas.0909080107 Arabidopsis synaptotagmin SYT1, a type I signal-anchor protein, requires tandem C2 domains for delivery to the plasma membrane.2010 · DOI: 10.1074/jbc.m109.084046
`At1g05500`	May be involved in membrane trafficking.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022045 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006612 protein targeting to membrane Biological Process

GO:0006869 lipid transport Biological Process

GO:0006897 endocytosis Biological Process

GO:0007029 endoplasmic reticulum organization Biological Process

GO:0009306 protein secretion Biological Process

GO:0009409 response to cold Biological Process

GO:0009612 response to mechanical stimulus Biological Process

GO:0009615 response to virus Biological Process

GO:0032456 endocytic recycling Biological Process

GO:0046740 transport of virus in host, cell to cell Biological Process

GO:0061817 endoplasmic reticulum-plasma membrane tethering Biological Process

GO:0000139 Golgi membrane Cellular Component

KEGG gene cross-reference

ath:AT1G05500

ath:AT1G20080

ath:AT2G20990

ath:AT5G04220

ath:AT5G11100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.663

Rank 1 · TkA05G442780 · TK1151

Cytoplasm0.221

Rank 2 · TkA05G442780 · TK1151

Endoplasmic reticulum0.149

Rank 3 · TkA05G442780 · TK1151

Nucleus0.086

Rank 4 · TkA05G442780 · TK1151

Golgi apparatus0.086

Rank 5 · TkA05G442780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17047SMP_LBD69-252 aa

PF25669SMP_MUG190-like72-143 aa

PF25669SMP_MUG190-like175-250 aa

PF00168C2265-364 aa

PF14429DOCK-C2296-323 aa

PF16153DUF4861307-382 aa

PF00168C2432-532 aa

PF14429DOCK-C2463-497 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G442780	`PF17047`	SMP_LBD	69	252	1.4e-17	64.5
TkA05G442780	`PF25669`	SMP_MUG190-like	72	143	5.7e-09	36.5
TkA05G442780	`PF25669`	SMP_MUG190-like	175	250	5.7e-09	36.5
TkA05G442780	`PF00168`	C2	265	364	8e-45	152.1
TkA05G442780	`PF14429`	DOCK-C2	296	323	0.14	12.8
TkA05G442780	`PF16153`	DUF4861	307	382	0.065	13.0
TkA05G442780	`PF00168`	C2	432	532	8e-45	152.1
TkA05G442780	`PF14429`	DOCK-C2	463	497	0.14	12.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q7XA06`	Arabidopsis thaliana	sp\|Q7XA06\|SYT3_ARATH Synaptotagmin-3	59.700%	Swiss-Prot	High
`B6ETT4`	Arabidopsis thaliana	sp\|B6ETT4\|SYT2_ARATH Synaptotagmin-2	52.200%	Swiss-Prot	High
`Q9SKR2`	Arabidopsis thaliana	sp\|Q9SKR2\|SYT1_ARATH Synaptotagmin-1	52.100%	Swiss-Prot	High
`Q8L706`	Arabidopsis thaliana	sp\|Q8L706\|SYT5_ARATH Synaptotagmin-5	32.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card