TkA05G436890 | RubberDandelionOmics

Gene overview

TkA05G436890

Reference: TK1151 Chr: Chr05 Coordinates: 109086566-109088778 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1423 bp · TkA05G436890|TK1151|cDNA

TTTTTCTTTAACAGTTCACTGAATGTTTTGTAAAATAAATTTTTTCATGCCATAAACTTTGGATTAATATTGATTGTGGTTTCCTATAAAAAACATCAGAATTCGAGGCTTGATAACAACAATATATACATATTTTCTCGGTTGCACTTTCTTCAATATTATTATTGGGAGCTCCTAGGCCTAGCTAACCAATAGTTCCCTAATCCAATGGGCCGTTAAATACATGAATTACCTCACTCACTACCTTTTAGAGCATTTGA...

CDS

Download CDS FASTA

642 bp · TkA05G436890|TK1151|CDS

ATGGCGATCGAGATCTGCTGCAAAGCTGCTACCGGAGCTCCTGACGTTCTTGGAGACTGTCCGTTTTGTCAAAGGGTTCTTTTGACTCTGGAAGAGAAGAAAGTAACTTACACCACCCATCTGATTAATCTGGACAACAAACCTCAATGGTTTCTCGAAGTGAACCCCGACGGGAAAGTTCCGTTGATAAAATTCGACGACAAATGGATTTCCGATTCAGACGTTATCGTGGGTTTGATCGAAGAGAAGTTCCCTGAACC...

Protein

Download Protein FASTA

213 aa · TkA05G436890|TK1151|PROTEIN

MAIEICCKAATGAPDVLGDCPFCQRVLLTLEEKKVTYTTHLINLDNKPQWFLEVNPDGKVPLIKFDDKWISDSDVIVGLIEEKFPEPSLSSSPEFASVGSKIFPKFVAFVKSKDTNDGSEQALIDELKSLDEHLKDHGPYVNGEKITAVDLSLAPKLYHLEVALGHFKKWTVPENLTHVHNYTKALFALESFEKTKAAKEHMIAGWAPKVNNA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G436890`
TK1151 ID	TkA05G436890
OH-1004 ID	LXL04_021979
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 92.208 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G436890

Location Chr05:109086566-109088778 (-)

Description Similar to DHAR2: Glutathione S-transferase DHAR2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g75270`	Displays a dual function.	Functional divergence in the glutathione transferase superfamily in plants. Identification of two classes with putative functions in redox homeostasis in Arabidopsis thaliana.2002 · DOI: 10.1074/jbc.m202919200 Cytosolic dehydroascorbate reductase is important for ozone tolerance in Arabidopsis thaliana.2006 · DOI: 10.1093/pcp/pci246
`At1g19570`	Displays a dual function.	A plant homolog of animal chloride intracellular channels (CLICs) generates an ion conductance in heterologous systems.2007 · DOI: 10.1074/jbc.m607241200
`At5g36270`	Exhibits glutathione-dependent thiol transferase and dehydroascorbate (DHA) reductase activities.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0116100`	Involved in ascorbate homeostasis.	Scavenging reactive oxygen species by rice dehydroascorbate reductase alleviates oxidative stresses in Escherichia coli.2008 · PMID: 19011360 Homologous expression of cytosolic dehydroascorbate reductase increases grain yield and biomass under paddy field conditions in transgenic rice (Oryza sativa L. japonica).2013 · DOI: 10.1007/s00425-013-1862-8 Structural understanding of the recycling of oxidized ascorbate by dehydroascorbate reductase (OsDHAR) from Oryza sativa L. japonica.2016 · DOI: 10.1038/srep19498
`Os06g0232600`	Involved in ascorbate homeostasis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021979 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009610 response to symbiotic fungus Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0010043 response to zinc ion Biological Process

GO:0010193 response to ozone Biological Process

GO:0010731 protein glutathionylation Biological Process

GO:0019852 L-ascorbic acid metabolic process Biological Process

GO:0033355 ascorbate glutathione cycle Biological Process

GO:0034220 monoatomic ion transmembrane transport Biological Process

GO:0043903 regulation of biological process involved in symbiotic interaction Biological Process

GO:0070301 cellular response to hydrogen peroxide Biological Process

GO:0080151 positive regulation of salicylic acid mediated signaling pathway Biological Process

KEGG gene cross-reference

ath:AT1G19570

ath:AT1G75270

dosa:Os05g0116100

dosa:Os06g0232600

osa:4337622

osa:4340581

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.795

Rank 1 · TkA05G436890 · TK1151

Nucleus0.244

Rank 2 · TkA05G436890 · TK1151

Mitochondrion0.111

Rank 3 · TkA05G436890 · TK1151

Cell membrane0.076

Rank 4 · TkA05G436890 · TK1151

Endoplasmic reticulum0.063

Rank 5 · TkA05G436890 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22441CLIC-like_N3-85 aa

PF13417GST_N_319-87 aa

PF00462Glutaredoxin19-68 aa

PF13409GST_N_220-82 aa

PF02798GST_N20-77 aa

PF17172GST_N_421-89 aa

PF10568Tom3753-86 aa

PF00043GST_C103-189 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G436890	`PF22441`	CLIC-like_N	3	85	1.5e-09	38.6
TkA05G436890	`PF13417`	GST_N_3	19	87	2.7e-17	63.6
TkA05G436890	`PF00462`	Glutaredoxin	19	68	0.0017	19.3
TkA05G436890	`PF13409`	GST_N_2	20	82	1.7e-18	67.7
TkA05G436890	`PF02798`	GST_N	20	77	8.4e-07	29.9
TkA05G436890	`PF17172`	GST_N_4	21	89	0.0032	18.8
TkA05G436890	`PF10568`	Tom37	53	86	0.19	12.8
TkA05G436890	`PF00043`	GST_C	103	189	0.00077	20.4
TkA05G436890	`PF14497`	GST_C_3	118	182	0.0018	19.2
TkA05G436890	`PF13410`	GST_C_2	120	184	8.3e-07	29.8
TkA05G436890	`PF17172`	GST_N_4	123	138	0.0032	18.8
TkA05G436890	`PF21972`	Arc1p_N_like	124	161	0.081	14.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FRL8`	Arabidopsis thaliana	sp\|Q9FRL8\|DHAR2_ARATH Glutathione S-transferase DHAR2	72.600%	Swiss-Prot	High
`Q9FWR4`	Arabidopsis thaliana	sp\|Q9FWR4\|DHAR1_ARATH Glutathione S-transferase DHAR1, mitochondrial	67.500%	Swiss-Prot	High
`Q9FG59`	Arabidopsis thaliana	sp\|Q9FG59\|DHAR4_ARATH Probable glutathione S-transferase DHAR4	66.700%	Swiss-Prot	High
`Q65XA0`	Oryza sativa subsp. japonica	sp\|Q65XA0\|DHAR1_ORYSJ Probable glutathione S-transferase DHAR1, cytosolic	67.900%	Swiss-Prot	High
`Q67UK9`	Oryza sativa subsp. japonica	sp\|Q67UK9\|DHAR2_ORYSJ Probable glutathione S-transferase DHAR2, chloroplastic	60.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card