TkA05G435940 | RubberDandelionOmics

Gene overview

TkA05G435940

Reference: TK1151 Chr: Chr05 Coordinates: 108820692-108829133 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4845 bp · TkA05G435940|TK1151|cDNA

ATGCAGTCACCAATACAACAACCACCACCCGGATTTGAAAACAGTGGGTTTGAAAACATCCCACAACCACAACCAATACCAATCCAACCACAACAAATACCCATACAACCACCAATTCAACAACAACTTATACCACCAGGACCTGTTCAACAAAACCCAAATGTAAATACCCAACAAACAAACGTACCACCACCAATACAACTGCAACCACCACAAAACAATTTCAACAACAACCCAGGAGGAAATGCAGCAAATTGGGG...

CDS

Download CDS FASTA

4845 bp · TkA05G435940|TK1151|CDS

ATGCAGTCACCAATACAACAACCACCACCCGGATTTGAAAACAGTGGGTTTGAAAACATCCCACAACCACAACCAATACCAATCCAACCACAACAAATACCCATACAACCACCAATTCAACAACAACTTATACCACCAGGACCTGTTCAACAAAACCCAAATGTAAATACCCAACAAACAAACGTACCACCACCAATACAACTGCAACCACCACAAAACAATTTCAACAACAACCCAGGAGGAAATGCAGCAAATTGGGG...

Protein

Download Protein FASTA

1614 aa · TkA05G435940|TK1151|PROTEIN

MQSPIQQPPPGFENSGFENIPQPQPIPIQPQQIPIQPPIQQQLIPPGPVQQNPNVNTQQTNVPPPIQLQPPQNNFNNNPGGNAANWGYNAGGNMGNFNQNQGRNFHQNQGNNFNFNQNNQGINWNNNNNGRNNTPNFDDEYDDGYVYNNGNNGNQGHLNNRYNVHNNPGFNGGFNNNQNFFPNLCFPQPNRQSVASHFQPSTHEDASPIIFPEGAQHHVILRPNLISIVPTFRDSTSQAMINASSGGTIMMQDSELAWQF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G435940`
TK1151 ID	TkA05G435940
OH-1004 ID	LXL04_038136
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	95.800
Protein coverage (%)	TK1151 74.287 / OH-1004 59.602 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G435940`
Location	Chr05:108820692-108829133 (+)
Description	Similar to TY3B-G: Transposon Ty3-G Gag-Pol polyprotein (Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_038136` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006281 DNA repair Biological Process GO:0006310 DNA recombination Biological Process GO:0006313 DNA transposition Biological Process GO:0006508 proteolysis Biological Process GO:0015074 DNA integration Biological Process GO:0075523 viral translational frameshifting Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0042575 DNA polymerase complex Cellular Component GO:0003676 nucleic acid binding Molecular Function GO:0003677 DNA binding Molecular Function GO:0003723 RNA binding Molecular Function
KEGG gene cross-reference	sce:YGR109W-B sce:YIL082W-A These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.769

Rank 1 · TkA05G435940 · TK1151

Nucleus0.334

Rank 2 · TkA05G435940 · TK1151

Endoplasmic reticulum0.055

Rank 3 · TkA05G435940 · TK1151

Cell membrane0.054

Rank 4 · TkA05G435940 · TK1151

Mitochondrion0.054

Rank 5 · TkA05G435940 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00098zf-CCHC301-315 aa

PF13975gag-asp_proteas624-709 aa

PF00078RVT_1972-1127 aa

PF17919RT_RNaseH_21192-1289 aa

PF17917RT_RNaseH1216-1319 aa

PF00665rve1268-1295 aa

PF17921Integrase_H2C21419-1475 aa

PF00098zf-CCHC1469-1477 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G435940	`PF00098`	zf-CCHC	301	315	1.9	9.4
TkA05G435940	`PF13975`	gag-asp_proteas	624	709	0.057	14.7
TkA05G435940	`PF00078`	RVT_1	972	1127	4.4e-28	99.2
TkA05G435940	`PF17919`	RT_RNaseH_2	1192	1289	5e-32	110.6
TkA05G435940	`PF17917`	RT_RNaseH	1216	1319	2.3e-36	124.9
TkA05G435940	`PF00665`	rve	1268	1295	4.3e-19	69.4
TkA05G435940	`PF17921`	Integrase_H2C2	1419	1475	6e-13	49.4
TkA05G435940	`PF00098`	zf-CCHC	1469	1477	1.9	9.4
TkA05G435940	`PF00665`	rve	1497	1590	4.3e-19	69.4
TkA05G435940	`PF13610`	DDE_Tnp_IS240	1514	1608	0.23	12.3
TkA05G435940	`PF29688`	TnsB_C	1546	1608	4e-06	27.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card