LXL04_038136 | RubberDandelionOmics

Gene overview

LXL04_038136

Reference: OH-1004 Chr: Chr09 Coordinates: 32000045-32007639 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

6033 bp · LXL04_038136|LXL04_038136|OH1004|cDNA

atgcaagcaagtcagaaatccatggaaagacaaattgctcaactatcggagcaaatcgggaaacgagaagctgggaagttcccgagtaacactgaagtcaatccatctcacacgcagagaggaaaggagcatcaagttaacgaggtaatcacacttcgtaacggaaagaaaatcgacaacaaggtaggtgctcctactcgagatgaggatagtgacactgaggtaatttttgatgaacaaactgaacaaaataaaaataa...

CDS

Download CDS FASTA

6033 bp · LXL04_038136|LXL04_038136|OH1004|CDS

ATGCAAGCAAGTCAGAAATCCATGGAAAGACAAATTGCTCAACTATCGGAGCAAATCGGGAAACGAGAAGCTGGGAAGTTCCCGAGTAACACTGAAGTCAATCCATCTCACACGCAGAGAGGAAAGGAGCATCAAGTTAACGAGGTAATCACACTTCGTAACGGAAAGAAAATCGACAACAAGGTAGGTGCTCCTACTCGAGATGAGGATAGTGACACTGAGGTAATTTTTGATGAACAAACTGAACAAAATAAAAATAA...

Protein

Download Protein FASTA

2010 aa · LXL04_038136|LXL04_038136|OH1004|PROTEIN

MQASQKSMERQIAQLSEQIGKREAGKFPSNTEVNPSHTQRGKEHQVNEVITLRNGKKIDNKVGAPTRDEDSDTEVIFDEQTEQNKNKKSQSSKCKKSKDPKVGEQGVENNTAPYPSAFESPASFPFGKRGPKMEDMWDLFNQVKINIPLVKLIREVPSYAKFLKDLCVHKRKLNTHLPKKVELTEHASSIISNTLPPKLKDPGAPLISVTIGNINIKKGLLDLGASVNILPGNLFDQIDLGTLEKTDMILQLADKSTKVP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038136`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_038136`
Location	Chr09:32000045-32007639 (+)
Description	Similar to TY3B-G: Transposon Ty3-G Gag-Pol polyprotein (Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_038136` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006281 DNA repair Biological Process GO:0006310 DNA recombination Biological Process GO:0006313 DNA transposition Biological Process GO:0006508 proteolysis Biological Process GO:0015074 DNA integration Biological Process GO:0075523 viral translational frameshifting Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0042575 DNA polymerase complex Cellular Component GO:0003676 nucleic acid binding Molecular Function GO:0003677 DNA binding Molecular Function GO:0003723 RNA binding Molecular Function
KEGG gene cross-reference	sce:YGR109W-B sce:YIL082W-A These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.578

Rank 1 · LXL04_038136 · OH-1004

Nucleus0.493

Rank 2 · LXL04_038136 · OH-1004

Mitochondrion0.051

Rank 3 · LXL04_038136 · OH-1004

Cell membrane0.039

Rank 4 · LXL04_038136 · OH-1004

Endoplasmic reticulum0.038

Rank 5 · LXL04_038136 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00078.33RVT_1566-721 aa

PF17919.8RT_RNaseH_2786-883 aa

PF17917.8RT_RNaseH812-913 aa

PF17921.8Integrase_H2C21013-1069 aa

PF00665.33rve1091-1184 aa

PF29688.1TnsB_C1140-1202 aa

PF31073.1DUF88031311-1370 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038136	`PF00078.33`	RVT_1	566	721	3.7e-28	99.5
LXL04_038136	`PF17919.8`	RT_RNaseH_2	786	883	2.7e-32	111.5
LXL04_038136	`PF17917.8`	RT_RNaseH	812	913	1.5e-36	125.4
LXL04_038136	`PF17921.8`	Integrase_H2C2	1013	1069	7.2e-13	49.2
LXL04_038136	`PF00665.33`	rve	1091	1184	5.9e-19	68.9
LXL04_038136	`PF29688.1`	TnsB_C	1140	1202	5.7e-06	26.9
LXL04_038136	`PF31073.1`	DUF8803	1311	1370	1.9e-08	34.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card