TkA05G433550 | RubberDandelionOmics

Gene overview

TkA05G433550

Reference: TK1151 Chr: Chr05 Coordinates: 108200814-108203918 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1914 bp · TkA05G433550|TK1151|cDNA

AAAAAAAAAAAAAAAAAAAAATCTACATCACCATATTCATCTGCATCGCCTCTCCTTGAGTTAACGAAGGGAATCGATTTCGATATGGTAAACGATTGAGCAGGTCGCTCAAAGCCTTTTTCTCGAATCGTCTTCTTCTCCTCACCGCAATCTTCATCTCTCACCAAATCGCTCAAAGCCTTTGATTAAGTTCAAATTAAATGGAGGTCTGACATTTTGCATAAATTACAACCTCAGTCCATCGGACCTTGTTTCGAGCT...

CDS

Download CDS FASTA

852 bp · TkA05G433550|TK1151|CDS

ATGAGGAACCTAACCACACTTGACTGGAATGGTGAAGGAACACTACTTGCAGCAGGCTCTTATGATGGGGAAGCCAGAATATGGAATAAAGACGGTGAGTTGGTAAGTACATTAACGAAACATAAAGGGCCAATATTCTCTCTAAAGTGGAACAAAAAAGGAGACTATCTTTTAAGTGGAAGTGTGGACAAAACTGCAATTGTTTGGGACATTAAAACAGGAGAATGGAAACAACAGTTTGAGTTTCACGCAGCTCCTAC...

Protein

Download Protein FASTA

283 aa · TkA05G433550|TK1151|PROTEIN

MRNLTTLDWNGEGTLLAAGSYDGEARIWNKDGELVSTLTKHKGPIFSLKWNKKGDYLLSGSVDKTAIVWDIKTGEWKQQFEFHAAPTLDVDWRNNVSFATYSTDNMIYVCKVGDNRPVKTFAGHQGEVNAIKWDPTGTLLASCSDDSTAKIWSLKQDTCLHDLKEHTKKIYTIRWSPTGPGTNKPNQPLVLASVSFDSTIKLWDVETGSLLHSLVAHGDPVYSVAFSPNGEYLASGSLDKCMHIWSVKEAKVVKTYVGSG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G433550`
TK1151 ID	TkA05G433550
OH-1004 ID	LXL04_031731
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	82.300
Protein coverage (%)	TK1151 97.880 / OH-1004 40.735 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G433550

Location Chr05:108200814-108203918 (+)

Description Similar to HOS15: WD40 repeat-containing protein HOS15

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g67320`	Acts as a repressor of cold stress-regulated gene expression.	Involvement of Arabidopsis HOS15 in histone deacetylation and cold tolerance.2008 · DOI: 10.1073/pnas.0801029105

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031731 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0002021 response to dietary excess Biological Process

GO:0006325 chromatin organization Biological Process

GO:0006338 chromatin remodeling Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009409 response to cold Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0016042 lipid catabolic process Biological Process

GO:0035264 multicellular organism growth Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0043627 response to estrogen Biological Process

KEGG gene cross-reference

ath:AT5G67320

mmu:21372

mmu:81004

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.498

Rank 1 · TkA05G433550 · TK1151

Cytoplasm0.448

Rank 2 · TkA05G433550 · TK1151

Cell membrane0.079

Rank 3 · TkA05G433550 · TK1151

Lysosome / Vacuole0.061

Rank 4 · TkA05G433550 · TK1151

Endoplasmic reticulum0.043

Rank 5 · TkA05G433550 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24805EIF3I2-107 aa

PF25174Beta-prop_THOC33-268 aa

PF24105Beta-prop_CAF1B_HIR13-25 aa

PF24780WD40_MABP1-WDR62_1st3-72 aa

PF24797Beta-prop_WDR35_TULP_N3-38 aa

PF23098Beta-prop_NOL10_N3-84 aa

PF25173Beta-prop_WDR3_1st4-90 aa

PF00400WD404-29 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G433550	`PF24805`	EIF3I	2	107	1.1e-28	101.1
TkA05G433550	`PF25174`	Beta-prop_THOC3	3	268	3.7e-52	177.7
TkA05G433550	`PF24105`	Beta-prop_CAF1B_HIR1	3	25	3.7e-29	102.6
TkA05G433550	`PF24780`	WD40_MABP1-WDR62_1st	3	72	7.7e-10	39.3
TkA05G433550	`PF24797`	Beta-prop_WDR35_TULP_N	3	38	2.3e-09	37.6
TkA05G433550	`PF23098`	Beta-prop_NOL10_N	3	84	9.6e-05	22.4
TkA05G433550	`PF25173`	Beta-prop_WDR3_1st	4	90	2e-61	207.7
TkA05G433550	`PF00400`	WD40	4	29	3.2e-53	176.6
TkA05G433550	`PF24814`	WD40_Prp19	4	77	9.3e-42	143.7
TkA05G433550	`PF24817`	WD40_WDHD1_1st	4	82	1.6e-40	139.8
TkA05G433550	`PF24807`	WD40_CDC20-Fz	4	214	1.1e-38	134.0
TkA05G433550	`PF23414`	Beta-prop_EML_2	4	95	1.3e-26	94.3
TkA05G433550	`PF12894`	ANAPC4_WD40	4	42	1.6e-24	86.6
TkA05G433550	`PF25460`	Beta-prop_Aladin	4	77	3.2e-23	83.1
TkA05G433550	`PF20426`	NBCH_WD40	4	77	3.9e-16	59.6
TkA05G433550	`PF23409`	Beta-prop_EML	4	75	2.2e-15	57.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FN19`	Arabidopsis thaliana	sp\|Q9FN19\|HOS15_ARATH WD40 repeat-containing protein HOS15	66.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card