TkA05G430590 | RubberDandelionOmics

Gene overview

TkA05G430590

Reference: TK1151 Chr: Chr05 Coordinates: 107388709-107392028 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1869 bp · TkA05G430590|TK1151|cDNA

ATGTACCAGGAAGAGGATAAAAGAGATCGAAGACGAAAAAATGGCATCGGAAACTACAATTATTACAAAATGTTTGGGTGTTTTAATCGGAAGTTCAAGATTACCGACCTGGGTCCACCGCAAGACGTAATCGACGTCTTCAGATTGTATTCCTCCGATGATGAGTCGGAGATGTTGCCGGGTGATTTTTTACGGTTCTTGATTGAGTTTCAGGGAGAAGAAGGAATCGCCATTGATGATGTGCAGCAGATTATGGATCG...

CDS

Download CDS FASTA

1869 bp · TkA05G430590|TK1151|CDS

ATGTACCAGGAAGAGGATAAAAGAGATCGAAGACGAAAAAATGGCATCGGAAACTACAATTATTACAAAATGTTTGGGTGTTTTAATCGGAAGTTCAAGATTACCGACCTGGGTCCACCGCAAGACGTAATCGACGTCTTCAGATTGTATTCCTCCGATGATGAGTCGGAGATGTTGCCGGGTGATTTTTTACGGTTCTTGATTGAGTTTCAGGGAGAAGAAGGAATCGCCATTGATGATGTGCAGCAGATTATGGATCG...

Protein

Download Protein FASTA

622 aa · TkA05G430590|TK1151|PROTEIN

MYQEEDKRDRRRKNGIGNYNYYKMFGCFNRKFKITDLGPPQDVIDVFRLYSSDDESEMLPGDFLRFLIEFQGEEGIAIDDVQQIMDRVLDLSSSHLTRYAFTVNDFFHYLLLDDINGPLKAQVHHDMTAPLQHYFIYTGHNSYLTGNQLSSDSSEVPIIRALQRGVRGIELDLWPNNARDGIHVLHGRTLTTPVTLLKCLKSIKEHAFVQSPYPVIITLEDHLTPSLQAKVAEMVTSTFGDMLYFPHPSDKDEFPSPDEL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G430590`
TK1151 ID	TkA05G430590
OH-1004 ID	LXL04_021857
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.300
Protein coverage (%)	TK1151 99.678 / OH-1004 49.411 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G430590

Location Chr05:107388709-107392028 (+)

Description Similar to PLC2: Phosphoinositide phospholipase C 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g40116`	The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes.	No verified direct reference in this release
`At5g58700`	The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes.	No verified direct reference in this release
`At3g08510`	The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes.	N-terminal EF-hand-like domain is required for phosphoinositide-specific phospholipase C activity in Arabidopsis thaliana.2001 · DOI: 10.1016/s0014-5793(01)02453-x
`At5g58690`	The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes.	No verified direct reference in this release
`At3g55940`	The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021857 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006950 response to stress Biological Process

GO:0009553 embryo sac development Biological Process

GO:0009556 microsporogenesis Biological Process

GO:0010601 positive regulation of auxin biosynthetic process Biological Process

GO:0016042 lipid catabolic process Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0048015 phosphatidylinositol-mediated signaling Biological Process

GO:0048437 floral organ development Biological Process

GO:0051209 release of sequestered calcium ion into cytosol Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004435 phosphatidylinositol-4,5-bisphosphate phospholipase C activity Molecular Function

KEGG gene cross-reference

ath:AT2G40116

ath:AT3G08510

ath:AT3G55940

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.429

Rank 1 · TkA05G430590 · TK1151

Cytoplasm0.399

Rank 2 · TkA05G430590 · TK1151

Nucleus0.221

Rank 3 · TkA05G430590 · TK1151

Endoplasmic reticulum0.078

Rank 4 · TkA05G430590 · TK1151

Golgi apparatus0.062

Rank 5 · TkA05G430590 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09279EF-hand_like41-116 aa

PF23583EF_HAND_2_PLCG53-110 aa

PF00388PI-PLC-X127-269 aa

PF00388PI-PLC-X319-360 aa

PF00387PI-PLC-Y385-473 aa

PF00168C2495-596 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G430590	`PF09279`	EF-hand_like	41	116	0.0012	20.0
TkA05G430590	`PF23583`	EF_HAND_2_PLCG	53	110	0.025	15.6
TkA05G430590	`PF00388`	PI-PLC-X	127	269	4.6e-52	176.2
TkA05G430590	`PF00388`	PI-PLC-X	319	360	4.6e-52	176.2
TkA05G430590	`PF00387`	PI-PLC-Y	385	473	2.3e-27	96.2
TkA05G430590	`PF00168`	C2	495	596	4.5e-13	50.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GV43`	Arabidopsis thaliana	sp\|Q8GV43\|PLCD6_ARATH Phosphoinositide phospholipase C 6	54.800%	Swiss-Prot	High
`Q944C1`	Arabidopsis thaliana	sp\|Q944C1\|PLCD4_ARATH Phosphoinositide phospholipase C 4	53.600%	Swiss-Prot	High
`Q39033`	Arabidopsis thaliana	sp\|Q39033\|PLCD2_ARATH Phosphoinositide phospholipase C 2	52.900%	Swiss-Prot	High
`Q944C2`	Arabidopsis thaliana	sp\|Q944C2\|PLCD5_ARATH Phosphoinositide phospholipase C 5	49.400%	Swiss-Prot	Medium
`Q9LY51`	Arabidopsis thaliana	sp\|Q9LY51\|PLCD7_ARATH Phosphoinositide phospholipase C 7	52.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card