LXL04_021857 | RubberDandelionOmics

Gene overview

LXL04_021857

Reference: OH-1004 Chr: Chr04 Coordinates: 138737648-138745972 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3822 bp · LXL04_021857|LXL04_021857|OH1004|cDNA

ATGTACCAGGAAGAGGATAAAAGAGATCGAAGACGAAAAAATGGCATCGGAAACTACAATTATTACAAAATGTTTGGGTGTTTTAATCGGAAGTTCAAGATTACCGACCTGGGTCCACCGCAAGACGTAATCGACGTCTTCAGATTGTATTCCTCCGATGATGAGTCGGAGATGTTGCCGGGTGATTTTTTACGGTTCTTGATTGAGTTTCAGGGAGAAGAAGGAATCGCCATTGATGATGTGCAGCAGATTATGGATCG...

CDS

Download CDS FASTA

3822 bp · LXL04_021857|LXL04_021857|OH1004|CDS

ATGTACCAGGAAGAGGATAAAAGAGATCGAAGACGAAAAAATGGCATCGGAAACTACAATTATTACAAAATGTTTGGGTGTTTTAATCGGAAGTTCAAGATTACCGACCTGGGTCCACCGCAAGACGTAATCGACGTCTTCAGATTGTATTCCTCCGATGATGAGTCGGAGATGTTGCCGGGTGATTTTTTACGGTTCTTGATTGAGTTTCAGGGAGAAGAAGGAATCGCCATTGATGATGTGCAGCAGATTATGGATCG...

Protein

Download Protein FASTA

1273 aa · LXL04_021857|LXL04_021857|OH1004|PROTEIN

MYQEEDKRDRRRKNGIGNYNYYKMFGCFNRKFKITDLGPPQDVIDVFRLYSSDDESEMLPGDFLRFLIEFQGEEGIAIDDVQQIMDRVLDLSSSHLTRYAFTVNDFFHYLLLDDINGPLKAQVHHDMTAPLQHYFIYTGHNSYLTGNQLSSDSSEVPIIRALQRGVRGIELDLWPNNARDGIHVLHGRTLTTPVTLLKCLKSIKEHAFVQSPYPVIITLEDHLTPSLQAKVAEMVTSTFGDMLYFPHPSDKDEFPSPDEL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021857`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021857

Location Chr04:138737648-138745972 (-)

Description Similar to PLC2: Phosphoinositide phospholipase C 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g08510`	The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes.	N-terminal EF-hand-like domain is required for phosphoinositide-specific phospholipase C activity in Arabidopsis thaliana.2001 · DOI: 10.1016/s0014-5793(01)02453-x
`At3g55940`	The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes.	No verified direct reference in this release
`At2g40116`	The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes.	No verified direct reference in this release
`At5g58700`	The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes.	No verified direct reference in this release
`At5g58690`	The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021857 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006950 response to stress Biological Process

GO:0009553 embryo sac development Biological Process

GO:0009556 microsporogenesis Biological Process

GO:0010601 positive regulation of auxin biosynthetic process Biological Process

GO:0016042 lipid catabolic process Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0048015 phosphatidylinositol-mediated signaling Biological Process

GO:0048437 floral organ development Biological Process

GO:0051209 release of sequestered calcium ion into cytosol Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004435 phosphatidylinositol-4,5-bisphosphate phospholipase C activity Molecular Function

KEGG gene cross-reference

ath:AT2G40116

ath:AT3G08510

ath:AT3G55940

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.467

Rank 1 · LXL04_021857 · OH-1004

Cytoplasm0.402

Rank 2 · LXL04_021857 · OH-1004

Nucleus0.189

Rank 3 · LXL04_021857 · OH-1004

Endoplasmic reticulum0.082

Rank 4 · LXL04_021857 · OH-1004

Golgi apparatus0.069

Rank 5 · LXL04_021857 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00388.26PI-PLC-X127-269 aa

PF00387.26PI-PLC-Y394-482 aa

PF00168.37C2504-605 aa

PF00388.26PI-PLC-X800-942 aa

PF00387.26PI-PLC-Y1040-1125 aa

PF00168.37C21146-1247 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021857	`PF00388.26`	PI-PLC-X	127	269	4.4e-106	351.4
LXL04_021857	`PF00387.26`	PI-PLC-Y	394	482	7.1e-58	194.5
LXL04_021857	`PF00168.37`	C2	504	605	3.8e-27	95.3
LXL04_021857	`PF00388.26`	PI-PLC-X	800	942	4.4e-106	351.4
LXL04_021857	`PF00387.26`	PI-PLC-Y	1040	1125	7.1e-58	194.5
LXL04_021857	`PF00168.37`	C2	1146	1247	3.8e-27	95.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39033`	Arabidopsis thaliana	Phosphoinositide phospholipase C 2	68.547%	Swiss-Prot	weak database homology
`Q9LY51`	Arabidopsis thaliana	Phosphoinositide phospholipase C 7	66.610%	Swiss-Prot	weak database homology
`Q8GV43`	Arabidopsis thaliana	Phosphoinositide phospholipase C 6	53.643%	Swiss-Prot	weak database homology
`Q944C1`	Arabidopsis thaliana	Phosphoinositide phospholipase C 4	55.482%	Swiss-Prot	weak database homology
`Q944C2`	Arabidopsis thaliana	Phosphoinositide phospholipase C 5	53.299%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card