RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA05G429570
Reference: TK1151 Chr: Chr05 Coordinates: 107162014-107172137 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2140 bp · TkA05G429570|TK1151|cDNA

AAAAGATTCCATATTTCCATTCCGAGACAATTTCTTATTTTCCTCGTATTTTTTGAAGATAAGATTTTGAAATATCTCAGGATTGCCTTTCCCTCTCCACCTTTAACAATCCATACGCCCAAAACCCTCACTGTTACTCTCTAATTCTCACTTCAATCCTCCCTAAACCTCCAATCAATCCAGCAATTTCAATGTCGCCAGCTTCGAGATGAGTTTTGCAGCAAGTATGACCGCGCCGGCGTGTTTTCGCGGGAACGTTG...

CDS

Download CDS FASTA

2775 bp · TkA05G429570|TK1151|CDS

ATGGTGTCTGCCGGAACTTCCACCTTCCGGGATCGGACATCAGAATTCCGATCTCTGTCGGACACATTGAAAAAGATTGGGCGAATACCAGCTCCCAGTCCAGATCGATCAAATCAGCAAAACGATCCATCGACGTCATCTAAACTACCGCTAACTCCTTCTTCATCTCGATCCGAATTCAACAAGAAGGCTTCTCGTATCGGATTAGGCATCCATGAAACCTCCAAAAAAATCTCCAGACTCGCCAATCTGGCTAAAAA...

Protein

Download Protein FASTA

924 aa · TkA05G429570|TK1151|PROTEIN

MVSAGTSTFRDRTSEFRSLSDTLKKIGRIPAPSPDRSNQQNDPSTSSKLPLTPSSSRSEFNKKASRIGLGIHETSKKISRLANLAKKSSIFDDPLKEIQELTALIKNDITSLNVAVSDLQTLQNIEISEGDYSQDRVVHSTAVCDDLKNKLMSATKKFQEVLTTRTENIKAHENRRQIFSTSIGRENPLRQQPKSVMDPPPWSSPPKPSPSHQPPESSGVQVGNQLRRRLAVDSTTTTSSSTPSQNTGPAMLQQQQLVPQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA05G429570
TK1151 IDTkA05G429570
OH-1004 IDLXL04_021872
Relationship / confidenceRbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)89.100
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA05G429570
LocationChr05:107162014-107172137 (-)
DescriptionSimilar to EGY2: Probable zinc metalloprotease EGY2, chloroplastic
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g05740 Probable membrane-associated metalloprotease that may be involved in chloroplast development. No verified direct reference in this release
At5g05760 Vesicle trafficking protein that functions in the secretory pathway. No verified direct reference in this release
At3g24350 Vesicle trafficking protein that functions in the secretory pathway. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
UniProt: B8AD72 Probable membrane-associated metalloprotease that may be involved in chloroplast development. No verified direct reference in this release
Os01g0142100 Probable membrane-associated metalloprotease that may be involved in chloroplast development. No verified direct reference in this release
Os03g0792400 Probable membrane-associated metalloprotease that may be involved in chloroplast development. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_021872 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006508 proteolysis Biological Process
GO:0006886 intracellular protein transport Biological Process
GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process
GO:0006906 vesicle fusion Biological Process
GO:0048278 vesicle docking Biological Process
GO:0061025 membrane fusion Biological Process
GO:0000139 Golgi membrane Cellular Component
GO:0005768 endosome Cellular Component
GO:0005794 Golgi apparatus Cellular Component
GO:0009504 cell plate Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0009535 chloroplast thylakoid membrane Cellular Component
KEGG gene cross-reference
ath:AT3G24350
ath:AT5G05740
ath:AT5G05760
dosa:Os01g0142100
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.953
Rank 1 · TkA05G429570 · TK1151
Endoplasmic reticulum0.029
Rank 2 · TkA05G429570 · TK1151
Golgi apparatus0.028
Rank 3 · TkA05G429570 · TK1151
Peroxisome0.026
Rank 4 · TkA05G429570 · TK1151
Cytoplasm0.026
Rank 5 · TkA05G429570 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11416Syntaxin-5_N5-25 aa
PF00804Syntaxin5-25 aa
PF10496Syntaxin-18_N10-67 aa
PF00804Syntaxin74-177 aa
PF11727ISG65-7578-171 aa
PF10496Syntaxin-18_N152-177 aa
PF05739SNARE264-334 aa
PF02163Peptidase_M50270-299 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA05G429570PF11416Syntaxin-5_N5250.0005819.7
TkA05G429570PF00804Syntaxin5251.69.2
TkA05G429570PF10496Syntaxin-18_N10670.08213.9
TkA05G429570PF00804Syntaxin741771.69.2
TkA05G429570PF11727ISG65-75781710.02514.9
TkA05G429570PF10496Syntaxin-18_N1521770.08213.9
TkA05G429570PF05739SNARE2643342.8e-1866.2
TkA05G429570PF02163Peptidase_M502702991.6e-1351.3
TkA05G429570PF10496Syntaxin-18_N4424670.08213.9
TkA05G429570PF27677EGY3_M5566332.2e-33114.7
TkA05G429570PF02163Peptidase_M506848551.6e-1351.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9FFK3Arabidopsis thalianasp|Q9FFK3|EGY2_ARATH Probable zinc metalloprotease EGY2, chloroplastic57.800%Swiss-ProtMedium
Q9FFK1Arabidopsis thalianasp|Q9FFK1|SYP31_ARATH Syntaxin-3160.800%Swiss-ProtHigh
Q9LK09Arabidopsis thalianasp|Q9LK09|SYP32_ARATH Syntaxin-3248.400%Swiss-ProtMedium
B8AD72Oryza sativa subsp. indicasp|B8AD72|EGY2_ORYSI Probable zinc metalloprotease EGY2, chloroplastic72.400%Swiss-ProtLow
Q0JQS5Oryza sativa subsp. japonicasp|Q0JQS5|EGY2_ORYSJ Probable zinc metalloprotease EGY2, chloroplastic72.400%Swiss-ProtLow
Q852K0Oryza sativa subsp. japonicasp|Q852K0|EGY1_ORYSJ Probable zinc metalloprotease EGY1, chloroplastic31.100%Swiss-ProtMedium

JBrowse

View in Genome Browser