LXL04_021872 | RubberDandelionOmics

Gene overview

LXL04_021872

Reference: OH-1004 Chr: Chr04 Coordinates: 138953745-138964004 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2952 bp · LXL04_021872|LXL04_021872|OH1004|cDNA

ATGGTGTCTGCCGGAACTTCCACCTTCCGGGATCGGACATCAGAATTCCGATCTCTGTCGGACACATTGAAAAAGATTGGGCGAATACCAGCTCCCAGTCCAGATCGATCAAATCAGCAAAACGATCCATCGACGTCATCTAAACTACCGCTAACTCCTTCTTCATCTCGATCCGAATTCAACAAGAAGGCTTCTCGTATCGGATTAGGCATCCATGAAACCTCCAAAAAAATCTCCAGACTCGCCAATCTGGCTAAAAA...

CDS

Download CDS FASTA

2952 bp · LXL04_021872|LXL04_021872|OH1004|CDS

ATGGTGTCTGCCGGAACTTCCACCTTCCGGGATCGGACATCAGAATTCCGATCTCTGTCGGACACATTGAAAAAGATTGGGCGAATACCAGCTCCCAGTCCAGATCGATCAAATCAGCAAAACGATCCATCGACGTCATCTAAACTACCGCTAACTCCTTCTTCATCTCGATCCGAATTCAACAAGAAGGCTTCTCGTATCGGATTAGGCATCCATGAAACCTCCAAAAAAATCTCCAGACTCGCCAATCTGGCTAAAAA...

Protein

Download Protein FASTA

983 aa · LXL04_021872|LXL04_021872|OH1004|PROTEIN

MVSAGTSTFRDRTSEFRSLSDTLKKIGRIPAPSPDRSNQQNDPSTSSKLPLTPSSSRSEFNKKASRIGLGIHETSKKISRLANLAKKSSIFDDPLKEIQELTALIKNDITSLNVAVSDLQTLQNIEISEGDYSQDRVVHSTAVCDDLKNKLMSATKKFQEVLTTRTENIKAHENRRQIFSTSIGRENPLRQQPKSVMDPPPWSSPPKPSPSHQPPESSGVQVGNQLRRRLAVDSTTTTSSSTPSQNMGPAMLQQQQLVPQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021872`
TK1151 ID	TkA05G429570
OH-1004 ID	LXL04_021872
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	89.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021872

Location Chr04:138953745-138964004 (+)

Description Similar to EGY2: Probable zinc metalloprotease EGY2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g05740`	Probable membrane-associated metalloprotease that may be involved in chloroplast development.	No verified direct reference in this release
`At5g05760`	Vesicle trafficking protein that functions in the secretory pathway.	No verified direct reference in this release
`At3g24350`	Vesicle trafficking protein that functions in the secretory pathway.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0142100`	Probable membrane-associated metalloprotease that may be involved in chloroplast development.	No verified direct reference in this release
`UniProt: B8AD72`	Probable membrane-associated metalloprotease that may be involved in chloroplast development.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021872 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0006886 intracellular protein transport Biological Process

GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process

GO:0006906 vesicle fusion Biological Process

GO:0048278 vesicle docking Biological Process

GO:0061025 membrane fusion Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0009504 cell plate Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

KEGG gene cross-reference

ath:AT3G24350

ath:AT5G05740

ath:AT5G05760

dosa:Os01g0142100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.937

Rank 1 · LXL04_021872 · OH-1004

Endoplasmic reticulum0.035

Rank 2 · LXL04_021872 · OH-1004

Mitochondrion0.033

Rank 3 · LXL04_021872 · OH-1004

Cytoplasm0.031

Rank 4 · LXL04_021872 · OH-1004

Golgi apparatus0.028

Rank 5 · LXL04_021872 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05739.27SNARE264-303 aa

PF27677.1EGY3_M556-633 aa

PF02163.29Peptidase_M50781-914 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021872	`PF05739.27`	SNARE	264	303	1.1e-08	35.5
LXL04_021872	`PF27677.1`	EGY3_M	556	633	2.4e-33	114.6
LXL04_021872	`PF02163.29`	Peptidase_M50	781	914	2.2e-11	44.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FFK3`	Arabidopsis thaliana	Probable zinc metalloprotease EGY2, chloroplastic	51.719%	Swiss-Prot	moderate database homology
`Q9FFK1`	Arabidopsis thaliana	Syntaxin-31	59.801%	Swiss-Prot	weak database homology
`Q9LK09`	Arabidopsis thaliana	Syntaxin-32	45.048%	Swiss-Prot	weak database homology
`Q0JQS5`	Oryza sativa subsp. japonica	Probable zinc metalloprotease EGY2, chloroplastic	54.623%	Swiss-Prot	moderate database homology
`B8AD72`	Oryza sativa subsp. indica	Probable zinc metalloprotease EGY2, chloroplastic	58.285%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card