TkA05G425650 | RubberDandelionOmics

Gene overview

TkA05G425650

Reference: TK1151 Chr: Chr05 Coordinates: 106147642-106148121 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

480 bp · TkA05G425650|TK1151|cDNA

GCCAACTTTCAAGAATCTCTGGAGGATTCCGGCAACGGGAGCGCGGTGCTCTCCCTATACCATGCGTTAAGCTCTCGCGACGTCCAAGTCGTCCACAAACTCTTAGCTCCTGACCTCGAGTGGTGGTTCCATGGCCCTCCGTCTCATCAGTTTATGATGCGATTACTTACCGGAACTGATAACGAAATCACCCAATCTTTTCAATTCGTGCCGCATTCAATTGACGCTTTCGGATCTACAGTCATCGTCGAAGGCTGCGA...

CDS

Download CDS FASTA

480 bp · TkA05G425650|TK1151|CDS

GCCAACTTTCAAGAATCTCTGGAGGATTCCGGCAACGGGAGCGCGGTGCTCTCCCTATACCATGCGTTAAGCTCTCGCGACGTCCAAGTCGTCCACAAACTCTTAGCTCCTGACCTCGAGTGGTGGTTCCATGGCCCTCCGTCTCATCAGTTTATGATGCGATTACTTACCGGAACTGATAACGAAATCACCCAATCTTTTCAATTCGTGCCGCATTCAATTGACGCTTTCGGATCTACAGTCATCGTCGAAGGCTGCGA...

Protein

Download Protein FASTA

159 aa · TkA05G425650|TK1151|PROTEIN

ANFQESLEDSGNGSAVLSLYHALSSRDVQVVHKLLAPDLEWWFHGPPSHQFMMRLLTGTDNEITQSFQFVPHSIDAFGSTVIVEGCDQRRDISWIHAWTVNSHGIITQVREYFNTSLTVTRFVNSTTPVSVTTLHCPSVWESSLANRVGKSVPGLVLAI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G425650`
TK1151 ID	TkA05G425650
OH-1004 ID	LXL04_000709
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	46.800
Protein coverage (%)	TK1151 93.082 / OH-1004 97.436 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G425650

Location Chr05:106147642-106148121 (+)

Description Similar to WUN1: Wound-induced protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g10985`	Senescence associated gene 20.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000709 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002238 response to molecule of fungal origin Biological Process

GO:0009620 response to fungus Biological Process

GO:0009624 response to nematode Biological Process

GO:0010150 leaf senescence Biological Process

GO:0010193 response to ozone Biological Process

KEGG gene cross-reference

ath:AT3G10985

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.509

Rank 1 · TkA05G425650 · TK1151

Nucleus0.318

Rank 2 · TkA05G425650 · TK1151

Cell membrane0.091

Rank 3 · TkA05G425650 · TK1151

Endoplasmic reticulum0.089

Rank 4 · TkA05G425650 · TK1151

Peroxisome0.085

Rank 5 · TkA05G425650 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10128OpcA_G6PD_assem16-69 aa

PF12680SnoaL_218-85 aa

PF07107WI1253-159 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G425650	`PF10128`	OpcA_G6PD_assem	16	69	0.23	12.2
TkA05G425650	`PF12680`	SnoaL_2	18	85	0.0027	19.0
TkA05G425650	`PF07107`	WI12	53	159	1.2e-44	151.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94AK6`	Arabidopsis thaliana	sp\|Q94AK6\|SAG20_ARATH Senescence associated gene 20	59.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card