TkA05G422990 | RubberDandelionOmics

Gene overview

TkA05G422990

Reference: TK1151 Chr: Chr05 Coordinates: 105447355-105454407 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1035 bp · TkA05G422990|TK1151|cDNA

ATGGTTGTGTTGATTGACGGCAGAGTTCAGCAGCGGCAGATATGCGTGTTTAAAGTGCAGTTTGTGGACAGTTTATCCAAAGGCCTTCAAGTGGGAGATTATTGGGATGAAGACCCTTGGCCCACCTTCTCACTTCAATCACGCCTCTTCCAACTTGCCAACTTGTATATTGCTTTTGGTGGAAAAGAGATGCCTTCTGTCCCCTATGCTTCAATCATTTTACCAGAAAGTTTTAATTCCGCACCGCAAGTGACGAAGAT...

CDS

Download CDS FASTA

1035 bp · TkA05G422990|TK1151|CDS

ATGGTTGTGTTGATTGACGGCAGAGTTCAGCAGCGGCAGATATGCGTGTTTAAAGTGCAGTTTGTGGACAGTTTATCCAAAGGCCTTCAAGTGGGAGATTATTGGGATGAAGACCCTTGGCCCACCTTCTCACTTCAATCACGCCTCTTCCAACTTGCCAACTTGTATATTGCTTTTGGTGGAAAAGAGATGCCTTCTGTCCCCTATGCTTCAATCATTTTACCAGAAAGTTTTAATTCCGCACCGCAAGTGACGAAGAT...

Protein

Download Protein FASTA

344 aa · TkA05G422990|TK1151|PROTEIN

MVVLIDGRVQQRQICVFKVQFVDSLSKGLQVGDYWDEDPWPTFSLQSRLFQLANLYIAFGGKEMPSVPYASIILPESFNSAPQVTKIEGRTSGDTAATTSPQLRRSDRGGFPYDILVTSHYFASVALSVRGWVGAWPESSGRYPPFKSPAPPSLMRRVREIWGSSSGAIRGTSSKNSQHFIRFTPNLVEVYNELAPNGDLDIVFISADEDLDSFNGYFSKMPWLAVPFSDSKTRESVDKSFKVNGIPHLVFLDENGKLLT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G422990`
TK1151 ID	TkA05G422990
OH-1004 ID	LXL04_029464
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	60.200
Protein coverage (%)	TK1151 60.465 / OH-1004 95.015 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G422990

Location Chr05:105447355-105454407 (+)

Description Similar to At1g60420: Probable nucleoredoxin 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g60420`	Probable thiol-disulfide oxidoreductase required for pollen tube growth and pollen function in the pistil.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0405900`	Probable thiol-disulfide oxidoreductase that may participate in various redox reactions.	No verified direct reference in this release
`Os03g0405500`	Probable thiol-disulfide oxidoreductase that may participate in various redox reactions.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029464 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009860 pollen tube growth Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0080092 regulation of pollen tube growth Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004791 thioredoxin-disulfide reductase (NADPH) activity Molecular Function

KEGG gene cross-reference

ath:AT1G60420

dosa:Os03g0405900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.305

Rank 1 · TkA05G422990 · TK1151

Nucleus0.276

Rank 2 · TkA05G422990 · TK1151

Mitochondrion0.169

Rank 3 · TkA05G422990 · TK1151

Plastid0.163

Rank 4 · TkA05G422990 · TK1151

Cell membrane0.126

Rank 5 · TkA05G422990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13905Thioredoxin_8174-257 aa

PF13098Thioredoxin_2232-259 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G422990	`PF13905`	Thioredoxin_8	174	257	3.5e-17	63.3
TkA05G422990	`PF13098`	Thioredoxin_2	232	259	0.021	15.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80763`	Arabidopsis thaliana	sp\|O80763\|NRX1_ARATH Probable nucleoredoxin 1	60.700%	Swiss-Prot	Low
`Q7Y0F2`	Oryza sativa subsp. japonica	sp\|Q7Y0F2\|NRX12_ORYSJ Probable nucleoredoxin 1-2	54.600%	Swiss-Prot	Low
`Q7Y0E8`	Oryza sativa subsp. japonica	sp\|Q7Y0E8\|NRX11_ORYSJ Probable nucleoredoxin 1-1	52.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card