TkA05G420600 | RubberDandelionOmics

Gene overview

TkA05G420600

Reference: TK1151 Chr: Chr05 Coordinates: 104767247-104769988 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1006 bp · TkA05G420600|TK1151|cDNA

CAAAACTACCACCGTCTCTGCTCCTGAAATCTCTCTGAAAATTTCAGCAATCCCCACTATATCTCAGCATTTGAAGATTTAATTGAAATTGAAACTCATCAATGCTCCCAATCGATGTTGACGATGCTGCTGGGTTGCTTGCCATGAATGGAAAACCTCCAAGGAAACATCGATGAGACCGAAACATCTTCTGTTCTCTCTCGATGTTATGATAGAGACCTTGATTACTCCAAATAAACGAGTACCGAATCAGGTATTCA...

CDS

Download CDS FASTA

621 bp · TkA05G420600|TK1151|CDS

ATGGACGGCGGAGCGGGGAAGAGGGCGGTGCATCCAGCGATTGAACCTCTGTCGTATCTGCTCGGAACTTGGAGAGGTCAAGGAGAAGGCGGTTTCCCCACCATATCTTCCTTCACGTACGACGAAGAGTTCAATTTCACTCATCCTGGCAACAAGCTTATTCCCACAAGCAGGTCTACTGTTAGTGAAGCAATCATTGATCCTGCTGCCATATTTGCAATGCTTTTTGGGAGTGAGCTATTTGAAGAATACATTGGACA...

Protein

Download Protein FASTA

206 aa · TkA05G420600|TK1151|PROTEIN

MDGGAGKRAVHPAIEPLSYLLGTWRGQGEGGFPTISSFTYDEEFNFTHPGNKLIPTSRSTVSEAIIDPAAIFAMLFGSELFEEYIGQLAMASTASLDIFPEGEQIDAKKLQEKMRVIQKEREEKLIQTLKDRLTPYVQGNKDEFVRNAEAEVLKLSNAVFRIFLQLMLWYIYARQAAKELGALALIQLQEDMKKQLSTESKNLKNT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G420600`
TK1151 ID	TkA05G420600
OH-1004 ID	LXL04_021781
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	93.700
Protein coverage (%)	TK1151 83.495 / OH-1004 79.909 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G420600

Location Chr05:104767247-104769988 (+)

Description Similar to ATJ10: Chaperone protein dnaJ 10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g76700`	Plays a continuous role in plant development probably in the structural organization of compartments.	No verified direct reference in this release
`At1g79260`	Heme-binding protein able to scavenge peroxynitrite and to protect free L-tyrosine against peroxynitrite-mediated nitration, by acting as a peroxynitrite isomerase that converts peroxynitrite to nitrate.	The structure and NO binding properties of the nitrophorin-like heme-binding protein from Arabidopsis thaliana gene locus At1g79260.1.2010 · DOI: 10.1002/prot.22617

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021781 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016853 isomerase activity Molecular Function

GO:0020037 heme binding Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0062213 peroxynitrite isomerase activity Molecular Function

KEGG gene cross-reference

ath:AT1G76700

ath:AT1G79260

mmi:MMAR_1995

msb:LJ00_32495

msg:MSMEI_6396

msm:MSMEG_6574

nfa:NFA_41140

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.415

Rank 1 · TkA05G420600 · TK1151

Mitochondrion0.301

Rank 2 · TkA05G420600 · TK1151

Nucleus0.228

Rank 3 · TkA05G420600 · TK1151

Peroxisome0.123

Rank 4 · TkA05G420600 · TK1151

Plastid0.074

Rank 5 · TkA05G420600 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08768THAP4_heme-bd14-54 aa

PF14308DnaJ-X118-187 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G420600	`PF08768`	THAP4_heme-bd	14	54	1.9e-11	45.0
TkA05G420600	`PF14308`	DnaJ-X	118	187	5.1e-10	39.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GYX8`	Arabidopsis thaliana	sp\|Q8GYX8\|DNJ10_ARATH Chaperone protein dnaJ 10	58.000%	Swiss-Prot	Medium
`O64527`	Arabidopsis thaliana	sp\|O64527\|NB_ARATH Peroxynitrite isomerase Rv2717c	60.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card