Gene Card
Gene overview
cDNA / CDS / Protein Sequences
687 bp · LXL04_021781|LXL04_021781|OH1004|cDNA
ATGGACGGCGGAGCGGGGAAGAGGGCGGTGCATCCAGCGATTGAACCTCTGTCGTATCTGCTCGGAACTTGGAGAGGTCAAGGAGAAGGCGGTTTCCCCACCATATCTTCCTTCACGTACGACGAAGAGTTCAATTTCACTCATCCTGGCAACAAGCTTATTCCCACAAGCAGGTCTACTGTTAGTGAAGCAATCATTGATCCTGCTGCCATATTTGCAATGCTTTTTGGGAGTGAGCTATTTGAAGAATACATTGGACA...
660 bp · LXL04_021781|LXL04_021781|OH1004|CDS
ATGGACGGCGGAGCGGGGAAGAGGGCGGTGCATCCAGCGATTGAACCTCTGTCGTATCTGCTCGGAACTTGGAGAGGTCAAGGAGAAGGCGGTTTCCCCACCATATCTTCCTTCACGTACGACGAAGAGTTCAATTTCACTCATCCTGGCAACAAGCTTATTCCCACAAGCAGGTCTACTGTTAGTGAAGCAATCATTGATCCTGCTGCCATATTTGCAATGCTTTTTGGGAGTGAGCTATTTGAAGAATACATTGGACA...
Protein
Download Protein FASTA219 aa · LXL04_021781|LXL04_021781|OH1004|PROTEIN
MDGGAGKRAVHPAIEPLSYLLGTWRGQGEGGFPTISSFTYDEEFNFTHPGNKLIPTSRSTVSEAIIDPAAIFAMLFGSELFEEYIGQLAMASTASLDIFPEGEQIDAKKLQEKMRVIQKEREEKLIQTLKDRLTPYVQGNKDEFVRNAEAEVLKLSNAGHVPFFCFLFNVFLYIYISNKNIPYFFTAYVVVYLCKTGSKRTWCTCSDSTSRRYEKAIEY
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_021781 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_021781 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:136842234-136844424 (+) | |||||||||
| Description | Similar to ATJ10: Chaperone protein dnaJ 10 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0009507 chloroplast Cellular Component GO:0016853 isomerase activity Molecular Function GO:0020037 heme binding Molecular Function GO:0046872 metal ion binding Molecular Function GO:0062213 peroxynitrite isomerase activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT1G76700 ath:AT1G79260 mmi:MMAR_1995 msb:LJ00_32495 msg:MSMEI_6396 msm:MSMEG_6574 nfa:NFA_41140 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF08768.18THAP4_heme-bd14-54 aaPF14308.12DnaJ-X118-158 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_021781 | PF08768.18 | THAP4_heme-bd | 14 | 54 | 2.3e-11 | 44.8 |
| LXL04_021781 | PF14308.12 | DnaJ-X | 118 | 158 | 3.1e-06 | 27.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.