Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1062 bp · TkA05G413680|TK1151|cDNA
AAAACCCTAAACCCTTGTTCCTATAAGAAGCTTCTGCTAGATACTTCACAGTTCTCACATAAACCCTAGCTAGCACAACCGTCGTAATCCTCTTATCGATATCAAGCATGAGGGCTCCAATCAGAGGAGGACGTGGTGGAGGCGGTGGTAGGGGACGCGGTGGAGGCAGAGGAGGACGTGGTGGTGGAATGAAAGGAGGAAGTAAGGTTATAGTTGAGCCACACAGACACGACGGTGTGTTTATTGCTAAAGGGAAGGAA...
921 bp · TkA05G413680|TK1151|CDS
ATGAGGGCTCCAATCAGAGGAGGACGTGGTGGAGGCGGTGGTTTCAGGGGTGGCCGTGGAGATGGCGGCGGTAGAGGAGGGGGCAGAGGGAGAGGAGGAGGAGGATTCAGTGGCGGAAGAGGTGCTGGTGGAAGGGGCGGTGGTAGGGGACGCGGTGGAGGCAGAGGAGGACGTGGTGGTGGAATGAAAGGAGGAAGTAAGGTTATAGTTGAGCCACACAGACACGACGGTGTGTTTATTGCTAAAGGGAAGGAAGATGC...
Protein
Download Protein FASTA306 aa · TkA05G413680|TK1151|PROTEIN
MRAPIRGGRGGGGGFRGGRGDGGGRGGGRGRGGGGFSGGRGAGGRGGGRGRGGGRGGRGGGMKGGSKVIVEPHRHDGVFIAKGKEDALCTRNMVPGEAVYNEKRISVQNEDGTKVEYRVWNPFRSKLAAAVLGGVDNIWMKPGSRVLYLGAASGTTVSHVSDLVGPTGAVYAVEFSHRSGRDLVNMAKKRTNVIPIIEDARHPAKYRMLVSMVDVIFSDVAQPDQARILALNASYFLKSGGYFVISIKANCIDSTVPAEA...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA05G413680 |
|---|---|
| TK1151 ID | TkA05G413680 |
| OH-1004 ID | LXL04_021648 |
| Relationship / confidence | Multi Candidate From Tk1151 / Complex relationship |
| Protein identity (%) | 99.700 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA05G413680 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr05:102928084-102930244 (-) | |||||||||
| Description | Similar to FIB1: rRNA 2'-O-methyltransferase fibrillarin 1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000451 rRNA 2'-O-methylation Biological Process GO:0000494 box C/D sno(s)RNA 3'-end processing Biological Process GO:0006364 rRNA processing Biological Process GO:0006952 defense response Biological Process GO:0016074 sno(s)RNA metabolic process Biological Process GO:0016556 mRNA modification Biological Process GO:0030490 maturation of SSU-rRNA Biological Process GO:0031167 rRNA methylation Biological Process GO:0042274 ribosomal small subunit biogenesis Biological Process GO:0048254 snoRNA localization Biological Process GO:0001650 fibrillar center Cellular Component GO:0001651 dense fibrillar component Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT4G25630 ath:AT5G52470 hsa:2091 mmu:14113 rno:292747 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF01189Methyltr_RsmB-F68-82 aaPF01269Fibrillarin70-297 aaPF08704GCD14138-233 aaPF01135PCMT138-190 aaPF13847Methyltransf_31141-252 aaPF01189Methyltr_RsmB-F142-219 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA05G413680 | PF01189 | Methyltr_RsmB-F | 68 | 82 | 0.0065 | 16.9 |
| TkA05G413680 | PF01269 | Fibrillarin | 70 | 297 | 2.2e-109 | 364.6 |
| TkA05G413680 | PF08704 | GCD14 | 138 | 233 | 1.9e-05 | 25.2 |
| TkA05G413680 | PF01135 | PCMT | 138 | 190 | 0.05 | 14.1 |
| TkA05G413680 | PF13847 | Methyltransf_31 | 141 | 252 | 0.0017 | 18.8 |
| TkA05G413680 | PF01189 | Methyltr_RsmB-F | 142 | 219 | 0.0065 | 16.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.