RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA05G412630
Reference: TK1151 Chr: Chr05 Coordinates: 102665437-102670850 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1330 bp · TkA05G412630|TK1151|cDNA

CCTTTTTCGACATTGCTTTAAAACCTCAAGTCAAGCGATCGTTTGTTTCAGTATTCTACTTCCTCTTCCTCGTCTGTTTCTAGAGGCTTCTCTGCAAGTCAATGGCGTCTGATCTCGTCGCCAAGGCCAAGGAGGCTTTCATCGACGACCACTTTGAACTCGCCGTTGACCTCTACTCCCAGGCAATCCTCATCAACCCTACCGACGCTGACCTGTTCTCCGACCGCTCTCAGGCTAACATCAAGCTCAAAAACTTCACA...

CDS

Download CDS FASTA

1077 bp · TkA05G412630|TK1151|CDS

ATGGCGTCTGATCTCGTCGCCAAGGCCAAGGAGGCTTTCATCGACGACCACTTTGAACTCGCCGTTGACCTCTACTCCCAGGCAATCCTCATCAACCCTACCGACGCTGACCTGTTCTCCGACCGCTCTCAGGCTAACATCAAGCTCAAAAACTTCACAGAAGCTGTTTCTGATGCGAACAAAGCAATTGAGTTGGACCCCGCAAATCCAAAACCATATCTGCGAAAAGGCATTGCATGTTTCAATCTTGAAGAATACCA...

Protein

Download Protein FASTA

358 aa · TkA05G412630|TK1151|PROTEIN

MASDLVAKAKEAFIDDHFELAVDLYSQAILINPTDADLFSDRSQANIKLKNFTEAVSDANKAIELDPANPKPYLRKGIACFNLEEYQTAKTAFEAGASLVQDGARFTEWIQKCDKCIAEENDEVLTTTQVPEKTNAVTKDVEQVNNVSSELATRTPVKPKYRHEFYQKPEEAVVTIFAKGIPTENVSVNFGEQILSVTINIPGEEAYNFQQRLFGKIIPANCKYVVLSTKIEIRLAKVEPLNWTTLEYAKDSLVVRNSNV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA05G412630
TK1151 IDTkA05G412630
OH-1004 IDLXL04_011926
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)74.700
Protein coverage (%)TK1151 100.000 / OH-1004 95.026
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA05G412630
LocationChr05:102665437-102670850 (-)
DescriptionSimilar to SGT1B: Protein SGT1 homolog B
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g11260 Involved in plant innate immunity.
Regulatory role of SGT1 in early R gene-mediated plant defenses.2002 · DOI: 10.1126/science.1067747
Arabidopsis SGT1b is required for defense signaling conferred by several downy mildew resistance genes.2002 · DOI: 10.1105/tpc.001123
Arabidopsis SGT1b is required for SCF(TIR1)-mediated auxin response.2003 · DOI: 10.1105/tpc.010884
Antagonistic control of disease resistance protein stability in the plant immune system.2005 · DOI: 10.1126/science.1109977
Role of SGT1 in resistance protein accumulation in plant immunity.2006 · DOI: 10.1038/sj.emboj.7601084
Interaction between SGT1 and cytosolic/nuclear HSC70 chaperones regulates Arabidopsis immune responses.2007 · DOI: 10.1105/tpc.107.051896
Enhanced defense responses in Arabidopsis induced by the cell wall protein fractions from Pythium oligandrum require SGT1, RAR1, NPR1 and JAR1.2009 · DOI: 10.1093/pcp/pcp044
SGT1 contributes to coronatine signaling and Pseudomonas syringae pv. tomato disease symptom development in tomato and Arabidopsis.2011 · DOI: 10.1111/j.1469-8137.2010.03470.x
At4g23570 Functions in R gene-mediated resistance, but participates in a lower extent than SGT1B to RPP5-mediated resistance.
Role of SGT1 in resistance protein accumulation in plant immunity.2006 · DOI: 10.1038/sj.emboj.7601084

Rice

Reference gene IDPossible functionPapers / DOI
Os01g0624500 May participate in basal resistance to bacterial blight in rice.
OsRAR1 and OsSGT1 physically interact and function in rice basal disease resistance.2008 · DOI: 10.1094/mpmi-21-3-0294
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_011926 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006511 ubiquitin-dependent protein catabolic process Biological Process
GO:0006952 defense response Biological Process
GO:0009408 response to heat Biological Process
GO:0009734 auxin-activated signaling pathway Biological Process
GO:0009793 embryo development ending in seed dormancy Biological Process
GO:0009867 jasmonic acid mediated signaling pathway Biological Process
GO:0010187 negative regulation of seed germination Biological Process
GO:0030163 protein catabolic process Biological Process
GO:0042742 defense response to bacterium Biological Process
GO:0045087 innate immune response Biological Process
GO:0050832 defense response to fungus Biological Process
GO:0051382 kinetochore assembly Biological Process
KEGG gene cross-reference
ath:AT4G11260
ath:AT4G23570
bta:515509
dosa:Os01g0624500
zma:103636097
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.770
Rank 1 · TkA05G412630 · TK1151
Nucleus0.412
Rank 2 · TkA05G412630 · TK1151
Mitochondrion0.070
Rank 3 · TkA05G412630 · TK1151
Peroxisome0.048
Rank 4 · TkA05G412630 · TK1151
Cell membrane0.047
Rank 5 · TkA05G412630 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07719TPR_28-35 aa
PF25575TPR_BSK1_C9-68 aa
PF29386CFAP70_mid_TPR9-104 aa
PF13428TPR_1415-38 aa
PF13432TPR_1615-70 aa
PF13371TPR_916-70 aa
PF13181TPR_817-34 aa
PF14559TPR_1917-56 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA05G412630PF07719TPR_28357.1e-1142.1
TkA05G412630PF25575TPR_BSK1_C9680.006217.1
TkA05G412630PF29386CFAP70_mid_TPR91040.2612.3
TkA05G412630PF13428TPR_1415380.003218.7
TkA05G412630PF13432TPR_1615700.007317.5
TkA05G412630PF13371TPR_916703.5e-0524.4
TkA05G412630PF13181TPR_817343.1e-0833.8
TkA05G412630PF14559TPR_1917560.0001123.1
TkA05G412630PF00515TPR_118354.2e-1039.7
TkA05G412630PF13414TPR_1118451.1e-0732.1
TkA05G412630PF13431TPR_1724557.4e-0832.8
TkA05G412630PF07719TPR_237697.1e-1142.1
TkA05G412630PF13181TPR_842693.1e-0833.8
TkA05G412630PF13428TPR_1442770.003218.7
TkA05G412630PF14853Fis1_TPR_C45690.06114.2
TkA05G412630PF00515TPR_147694.2e-1039.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9SUT5Arabidopsis thalianasp|Q9SUT5|SGT1B_ARATH Protein SGT1 homolog B54.000%Swiss-ProtHigh
Q9SUR9Arabidopsis thalianasp|Q9SUR9|SGT1A_ARATH Protein SGT1 homolog A48.600%Swiss-ProtMedium
Q0JL44Oryza sativa subsp. japonicasp|Q0JL44|SGT1_ORYSJ Protein SGT1 homolog61.300%Swiss-ProtHigh

JBrowse

View in Genome Browser