TkA05G411730 | RubberDandelionOmics

Gene overview

TkA05G411730

Reference: TK1151 Chr: Chr05 Coordinates: 102427736-102429782 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

896 bp · TkA05G411730|TK1151|cDNA

GAGGAGATAGTTTTTTAATATCAAAACGAGTGAAAACAAGCCCGATCGTTGCTTTGAGTTACGCTTCTCACCGTTACCCCCATCGGTCCTTCCACCCCCTGAACATCGCTCTTTCTCGGGCCGTACATAGTGAAAACGAGCTTCATTCATCACACTTCCGAAGCGCTTCTCCGGTCAAGAGTGAAAACGAGCCCTAGCTGCCTCACCTCGCTTCTACTATCTATTGTCGCCGCTCACCACACTTTGAAAGTAAACGTTGA...

CDS

Download CDS FASTA

546 bp · TkA05G411730|TK1151|CDS

ATGGCATCTCATATTGTCGGTTATCCACGTATGGGACCAAAACGAGAGCTGAAATTTGCGCTTGAATCGTTTTGGGATGGTAAGAGCAGTGCCGACGACTTGCAGAAAGTTGCTTCTGAAATTCGATCAAGCATCTGGAAACAGATGAAGGACGCCGGTATCAAATATATCCCTAGCAACACCTTCTCTTTCTACGATCAAGTCCTTGACACCACCTGCCATGGAAATGACCAAATGGTTCGGCACAAATTAGCAAGTCA...

Protein

Download Protein FASTA

181 aa · TkA05G411730|TK1151|PROTEIN

MASHIVGYPRMGPKRELKFALESFWDGKSSADDLQKVASEIRSSIWKQMKDAGIKYIPSNTFSFYDQVLDTTCHGNDQMVRHKLASHYRIERSRCNMDPTKLTGRVITSVTWPNSNHLKIVWRLKISHSKLMRQPELATAQRALRSQRIRQKGDTGNEHVVSRSHGFRALPLNRKVCILSF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G411730`
TK1151 ID	TkA05G411730
OH-1004 ID	LXL04_032887
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	87.200
Protein coverage (%)	TK1151 99.448 / OH-1004 90.625 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G411730

Location Chr05:102427736-102429782 (+)

Description Similar to Os12g0624000: 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0624000`	Catalyzes the transfer of a methyl group from 5-methyltetrahydrofolate to homocysteine resulting in methionine formation.	No verified direct reference in this release
`Os12g0623900`	Catalyzes the transfer of a methyl group from 5-methyltetrahydrofolate to homocysteine resulting in methionine formation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032887 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009086 methionine biosynthetic process Biological Process

GO:0032259 methylation Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0003871 5-methyltetrahydropteroyltriglutamate-homocysteine S-methyltransferase activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0008705 methionine synthase activity Molecular Function

KEGG gene cross-reference

ag:CAA58474

dosa:Os12g0623900

dosa:Os12g0624000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.400

Rank 1 · TkA05G411730 · TK1151

Nucleus0.261

Rank 2 · TkA05G411730 · TK1151

Mitochondrion0.215

Rank 3 · TkA05G411730 · TK1151

Plastid0.116

Rank 4 · TkA05G411730 · TK1151

Peroxisome0.109

Rank 5 · TkA05G411730 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08267Meth_synt_13-84 aa

PF28870C3orf85_N15-68 aa

PF12214TPX2_importin133-176 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G411730	`PF08267`	Meth_synt_1	3	84	3.8e-28	99.6
TkA05G411730	`PF28870`	C3orf85_N	15	68	0.16	12.7
TkA05G411730	`PF12214`	TPX2_importin	133	176	0.0011	20.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q2QLY4`	Oryza sativa subsp. japonica	sp\|Q2QLY4\|METE2_ORYSJ 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 2	88.900%	Swiss-Prot	Low
`Q2QLY5`	Oryza sativa subsp. japonica	sp\|Q2QLY5\|METE1_ORYSJ 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 1	88.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card