TkA05G408170 | RubberDandelionOmics

Gene overview

TkA05G408170

Reference: TK1151 Chr: Chr05 Coordinates: 101490373-101491776 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

908 bp · TkA05G408170|TK1151|cDNA

ATATGAGGACAATGGAGAAAATCGTTAACGGATGGATAATAGTTCGTAACGAAGCATTTCACCGCTAAAAAATGGCGACCCTTTTCCTTCCTCTCTCACATAACTTTTCTTCTCCGAAACTCTCCTCCGCCGTGAAATATTCCCGTCTCCCCGTTCGCTTTCACCTCCATTCATCGATCCGCATCAACTGCTCCGCCAATCCAAACGATTCAATCTCCACATCTAAAGAAAATTCATCACAATTCAAGGAGCTACGAAAC...

CDS

Download CDS FASTA

729 bp · TkA05G408170|TK1151|CDS

ATGGCGACCCTTTTCCTTCCTCTCTCACATAACTTTTCTTCTCCGAAACTCTCCTCCGCCGTGAAATATTCCCGTCTCCCCGTTCGCTTTCACCTCCATTCATCGATCCGCATCAACTGCTCCGCCAATCCAAACGATTCAATCTCCACATCTAAAGAAAATTCATCACAATTCAAGGAGCTACGAAACGTAGCTTGCGGAGTCCTCGCCGTATTAGCTCTTACCACCACCTCGCCTGTAATCGCAGCTAATCAGCGGCT...

Protein

Download Protein FASTA

242 aa · TkA05G408170|TK1151|PROTEIN

MATLFLPLSHNFSSPKLSSAVKYSRLPVRFHLHSSIRINCSANPNDSISTSKENSSQFKELRNVACGVLAVLALTTTSPVIAANQRLPPLSTDPDRCSRAFVGNTIGQANGVYDKAIDLRFCDYTNEKENLKGKSLAAALMSGAKFDGADMTEVVMSKAYAVGASFKGTDFTNAVLDRVNFGKADLTGASFKNTVLSGSTFEEAQLKDVVFEDTIIGYIDLQKLCVNKTINEDSRLELGCRN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G408170`
TK1151 ID	TkA05G408170
OH-1004 ID	LXL04_021581
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G408170

Location Chr05:101490373-101491776 (+)

Description Similar to TL17: Thylakoid lumenal 17.4 kDa protein, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g53490`	Thylakoid lumenal 17.4 kDa protein, chloroplastic.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021581 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005576 extracellular region Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0009543 chloroplast thylakoid lumen Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0031977 thylakoid lumen Cellular Component

KEGG gene cross-reference

ath:AT1G12250

ath:AT5G53490

cyt:cce_1272

syn:slr0516

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.980

Rank 1 · TkA05G408170 · TK1151

Mitochondrion0.020

Rank 2 · TkA05G408170 · TK1151

Nucleus0.008

Rank 3 · TkA05G408170 · TK1151

Cell membrane0.008

Rank 4 · TkA05G408170 · TK1151

Cytoplasm0.007

Rank 5 · TkA05G408170 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00805Pentapeptide136-173 aa

PF13576Pentapeptide_3139-174 aa

PF13599Pentapeptide_4141-169 aa

PF13599Pentapeptide_4165-223 aa

PF13576Pentapeptide_3171-214 aa

PF00805Pentapeptide175-213 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G408170	`PF00805`	Pentapeptide	136	173	5.8e-17	61.6
TkA05G408170	`PF13576`	Pentapeptide_3	139	174	5.5e-11	43.2
TkA05G408170	`PF13599`	Pentapeptide_4	141	169	3.8e-10	40.4
TkA05G408170	`PF13599`	Pentapeptide_4	165	223	3.8e-10	40.4
TkA05G408170	`PF13576`	Pentapeptide_3	171	214	5.5e-11	43.2
TkA05G408170	`PF00805`	Pentapeptide	175	213	5.8e-17	61.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P81760`	Arabidopsis thaliana	sp\|P81760\|TL17_ARATH Thylakoid lumenal 17.4 kDa protein, chloroplastic	67.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card