TkA05G405500 | RubberDandelionOmics

Gene overview

TkA05G405500

Reference: TK1151 Chr: Chr05 Coordinates: 100863701-100865857 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1680 bp · TkA05G405500|TK1151|cDNA

TTGACCAGTACCTCCAAAATATATACTGGAACTGAAGCAAGTCAAACATGGCTGAAGAAACCAATAAAAGTTCGGAAATTATAAAGAAGAAAATGCCAATTATAGAGAAGCATCAAATTTCTGATTTTTAAAGCAGTTTATTAGGAGAAATTTGAAGAAAATGATCAAATTTCCGATTTTATAAAACTTTCTGATCTCAATCTCCGGGTGACAGTATCAGAAGACCTAATTTTTCGAAGATGCTTCAAATTTTGATTCTT...

CDS

Download CDS FASTA

1302 bp · TkA05G405500|TK1151|CDS

ATGCTTCAAATTTTGATTCTTCGTTCGTTTGGAATCCTCCTACTGCTCTGGGTTCTACTTCCTTCATCAATTCAAATCGTAGATTGCGATGAACACTACAGGACGCAGCTTCTAACCGCCGCTGAACAAGATAAAGATTGGTTGATTTCAATCAGAAGAAAACTCCATGAGTACCCCGAACTCCTTTTCCAAGAACACAAAACCAGTGCCCTAATTCGCAACGAGCTCGACAAACTCGGCGTTTCTTACACATACCCAAT...

Protein

Download Protein FASTA

433 aa · TkA05G405500|TK1151|PROTEIN

MLQILILRSFGILLLLWVLLPSSIQIVDCDEHYRTQLLTAAEQDKDWLISIRRKLHEYPELLFQEHKTSALIRNELDKLGVSYTYPIAKTGFVAQIGTGSPPVVALRADMDALPLQELVEWEHKSKNDGIMHGCGHDAHTTMLLGAAKLLNQRKHNLNGTVRLIFQPAEEGGAGASHMINEGALGKSQAIFGMHVDFTIPTGTIATLSGPMLAAVCFFKAKIEGKGGHAADPHNTVDPILAASSTVLALQNLISRELDPL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G405500`
TK1151 ID	TkA05G405500
OH-1004 ID	LXL04_020952
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	51.900
Protein coverage (%)	TK1151 90.762 / OH-1004 88.409 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G405500

Location Chr05:100863701-100865857 (+)

Description Similar to ILL4: IAA-amino acid hydrolase ILR1-like 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g54140`	Hydrolyzes certain amino acid conjugates of the plant growth regulator indole-3-acetic acid (IAA).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0521800`	Hydrolyzes certain amino acid conjugates of the plant growth regulator indole-3-acetic acid (IAA).	No verified direct reference in this release
`Os07g0249700`	Hydrolyzes certain amino acid conjugates of the plant growth regulator indole-3-acetic acid (IAA).	No verified direct reference in this release
`Os03g0836800`	Hydrolyzes certain amino acid conjugates of the plant growth regulator indole-3-acetic acid (IAA).	No verified direct reference in this release
`Os07g0249900`	Hydrolyzes certain amino acid conjugates of the plant growth regulator indole-3-acetic acid (IAA).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020952 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009611 response to wounding Biological Process

GO:0009850 auxin metabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005788 endoplasmic reticulum lumen Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0010178 IAA-amino acid conjugate hydrolase activity Molecular Function

GO:0010179 IAA-Ala conjugate hydrolase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G51760

ath:AT5G56650

ath:AT5G56660

dosa:Os01g0560000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.212

Rank 1 · TkA05G405500 · TK1151

Cytoplasm0.203

Rank 2 · TkA05G405500 · TK1151

Lysosome / Vacuole0.190

Rank 3 · TkA05G405500 · TK1151

Peroxisome0.128

Rank 4 · TkA05G405500 · TK1151

Extracellular0.120

Rank 5 · TkA05G405500 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01546Peptidase_M20105-420 aa

PF04389Peptidase_M28140-182 aa

PF07687M20_dimer218-312 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G405500	`PF01546`	Peptidase_M20	105	420	1.7e-42	146.4
TkA05G405500	`PF04389`	Peptidase_M28	140	182	0.018	15.5
TkA05G405500	`PF07687`	M20_dimer	218	312	1.7e-11	44.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O81641`	Arabidopsis thaliana	sp\|O81641\|ILL3_ARATH IAA-amino acid hydrolase ILR1-like 3	64.600%	Swiss-Prot	High
`Q7XUA8`	Oryza sativa subsp. japonica	sp\|Q7XUA8\|ILL5_ORYSJ IAA-amino acid hydrolase ILR1-like 5	64.900%	Swiss-Prot	High
`Q8H3C9`	Oryza sativa subsp. japonica	sp\|Q8H3C9\|ILL7_ORYSJ IAA-amino acid hydrolase ILR1-like 7	55.800%	Swiss-Prot	High
`Q851L5`	Oryza sativa subsp. japonica	sp\|Q851L5\|ILL3_ORYSJ IAA-amino acid hydrolase ILR1-like 3	54.500%	Swiss-Prot	High
`Q8H3C7`	Oryza sativa subsp. japonica	sp\|Q8H3C7\|ILL9_ORYSJ IAA-amino acid hydrolase ILR1-like 9	54.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card