RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA05G402120
Reference: TK1151 Chr: Chr05 Coordinates: 100088683-100092374 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3430 bp · TkA05G402120|TK1151|cDNA

AAGAACACCCTGGAGATGGACCCACTTTTTGAATAATTGATGTACCCTCTTATTAATCAATCATCACTCACCTCCCTCACTCCATGAGAAGAACACAAACACCACGGATTTCATCACCTCCGTCATCTCCTCCGATTCAACATGAAACTTCACATGTAAACTCATCGGAATCATATCATTCATACTCTTTCATTCCCAGAAATGGAATCCCGTATGATCACCTATCTAAACTGCACTTGCATTGCCTTCCTTCTTCTCCT...

CDS

Download CDS FASTA

2889 bp · TkA05G402120|TK1151|CDS

ATGGAATCCCGTATGATCACCTATCTAAACTGCACTTGCATTGCCTTCCTTCTTCTCCTTCCTCTGTTTTTTGCTGACGGAAAAGTTTTAATTTCCGCGCCCAATGATGAAATCTCGTCACTCCTCTCTATCAAATCCGCCATTGTCGATTCTTTAAGCTATCTCGCAGACTGGAACTCGTCGTCGCCGTCAATTTCTTCATCGCACTGCAACTGGACTGGAGTTTCATGCAATGAAGATGGCTTTGTTGAAAAGCTTGA...

Protein

Download Protein FASTA

962 aa · TkA05G402120|TK1151|PROTEIN

MESRMITYLNCTCIAFLLLLPLFFADGKVLISAPNDEISSLLSIKSAIVDSLSYLADWNSSSPSISSSHCNWTGVSCNEDGFVEKLDLSSMNLTGNISDDFQNFHHLSFLNISTNGFSTTLPKSFANLTSLVTMDVSENNFVGEFPEGFGIGATRLKTVNASSNNFSGFLPEYLANATSLETLDFRGSFFVGSIPKSYRNLRNLKFLGLSGNNLTGEIPPEIGELSSLEVIIIGYNGFEGSIPPEIGNLSNLQYLDLAVG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA05G402120
TK1151 IDTkA05G402120
OH-1004 IDLXL04_021532
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)97.500
Protein coverage (%)TK1151 99.792 / OH-1004 87.035
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA05G402120
LocationChr05:100088683-100092374 (+)
DescriptionSimilar to PXL1: Leucine-rich repeat receptor-like protein kinase PXL1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g28650 Involved in the regulation of procambium maintenance and polarity during vascular-tissue development.
A receptor heteromer mediates the male perception of female attractants in plants.2016 · DOI: 10.1038/nature16975
At1g08590 Involved in the regulation of procambium maintenance and polarity during vascular-tissue development. No verified direct reference in this release
At5g61480 Acts with CLE41p and CLE44p peptides as a ligand-receptor pair in a signal transduction pathway involved in the regulation of procambium maintenance and polarity during vascular-tissue development. No verified direct reference in this release
At3g49670 LRR-rich receptor-like kinase (LRR-RLK) implicated in the detection of the CLAVATA-family peptides (CLEs), and to the regulation of the triggered signaling required for protophloem differentiation and meristems maintenance through the phosphorylation of CIK proteins (CIKs) and, probably, of PBL34, PBL35 and PBL36. No verified direct reference in this release
At5g65700 LRR-rich receptor-like kinase (LRR-RLK) that, similarly to CLV1 and BAM3, participates in the detection of the CLAVATA-family peptides (e.g. CLE25, CLE26 and CLE45), and to the regulation of the triggered signaling required for protophloem differentiation and meristems maintenance through the phosphorylation of CIK proteins (CIKs) and of PBL34, PBL35 and PBL36. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_021532 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006468 protein phosphorylation Biological Process
GO:0009755 hormone-mediated signaling pathway Biological Process
GO:0009934 regulation of meristem structural organization Biological Process
GO:0010067 procambium histogenesis Biological Process
GO:0010075 regulation of meristem growth Biological Process
GO:0010087 phloem or xylem histogenesis Biological Process
GO:0010089 xylem development Biological Process
GO:0010183 pollen tube guidance Biological Process
GO:0010223 secondary shoot formation Biological Process
GO:0030154 cell differentiation Biological Process
GO:0035556 intracellular signal transduction Biological Process
GO:0046777 protein autophosphorylation Biological Process
KEGG gene cross-reference
ath:AT1G08590
ath:AT3G49670
ath:AT4G28650
ath:AT5G61480
ath:AT5G65700
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.865
Rank 1 · TkA05G402120 · TK1151
Endoplasmic reticulum0.091
Rank 2 · TkA05G402120 · TK1151
Cytoplasm0.056
Rank 3 · TkA05G402120 · TK1151
Nucleus0.036
Rank 4 · TkA05G402120 · TK1151
Lysosome / Vacuole0.030
Rank 5 · TkA05G402120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263LRRNT_235-78 aa
PF00560LRR_184-104 aa
PF13855LRR_884-141 aa
PF12799LRR_484-121 aa
PF25013LRR_Zer-184-108 aa
PF23598LRR_1486-184 aa
PF24048LRR_NXF1-597-120 aa
PF29870YDR417C103-123 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA05G402120PF08263LRRNT_235787.3e-1039.7
TkA05G402120PF00560LRR_1841044.1e-58181.4
TkA05G402120PF13855LRR_8841417.4e-45151.3
TkA05G402120PF12799LRR_4841211.2e-37127.7
TkA05G402120PF25013LRR_Zer-1841089.1e-0626.6
TkA05G402120PF23598LRR_14861841.5e-36126.6
TkA05G402120PF24048LRR_NXF1-5971201.19.6
TkA05G402120PF29870YDR417C1031230.0004321.0
TkA05G402120PF00560LRR_11061284.1e-58181.4
TkA05G402120PF23286LRR_131191386.5e-0626.7
TkA05G402120PF25013LRR_Zer-11191439.1e-0626.6
TkA05G402120PF12799LRR_41231451.2e-37127.7
TkA05G402120PF29870YDR417C1281540.0004321.0
TkA05G402120PF00560LRR_11301504.1e-58181.4
TkA05G402120PF12799LRR_41541931.2e-37127.7
TkA05G402120PF00560LRR_11551764.1e-58181.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9M0G7Arabidopsis thalianasp|Q9M0G7|MIK1_ARATH MDIS1-interacting receptor like kinase 163.600%Swiss-ProtLow
Q9FRS6Arabidopsis thalianasp|Q9FRS6|PXL1_ARATH Leucine-rich repeat receptor-like protein kinase PXL160.300%Swiss-ProtLow
Q9FII5Arabidopsis thalianasp|Q9FII5|TDR_ARATH Leucine-rich repeat receptor-like protein kinase TDR43.200%Swiss-ProtLow
Q9M2Z1Arabidopsis thalianasp|Q9M2Z1|BAME2_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM248.600%Swiss-ProtLow
O49545Arabidopsis thalianasp|O49545|BAME1_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM145.800%Swiss-ProtLow

JBrowse

View in Genome Browser