TkA05G402050 | RubberDandelionOmics

Gene overview

TkA05G402050

Reference: TK1151 Chr: Chr05 Coordinates: 100068976-100071317 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2026 bp · TkA05G402050|TK1151|cDNA

ATTTGATTCGCTCGCTCCCTACTGTTTTGACTGTTTGTAGGCAGACCCACTGAATTACCCTCTGGACTCACCTCCCTACTCTTTCCCTTCATCAAATTCTCCAATTCCCCCAAATTCTTGTCTCTTAGATGCGCATTTTGTCGATCAAACCCTTTTATAATGTTCCCATCAACGCTCTTCGATCTGCTCTCTTTAATATAAGAAGCTATAACCACCCAGCAAGAATCACAATCACAACCAATCCCAATTTCAGACTTTCT...

CDS

Download CDS FASTA

543 bp · TkA05G402050|TK1151|CDS

ATGCATGGCTCTTTTTGCCAAGAATGGGGTTTTGATGTATCCAAAGAAACAATCCCAAACTCTGCAACTCTGAAATACACCGACTTCTTGTTCGCAACAGCGTCTGGGAAGATCGACGGCATAAATTGCTCTTCAAATCTAACTCCCCATTTTGAAAAAGCAAAAATTGCCGCATTCACTATAAGCGCAATGGTCCCTTGCATGAAGCTTTACGCTTTTCTCGGGAAAGGAGCTCAATTTCTGGTTGATGTAAATAACAA...

Protein

Download Protein FASTA

180 aa · TkA05G402050|TK1151|PROTEIN

MHGSFCQEWGFDVSKETIPNSATLKYTDFLFATASGKIDGINCSSNLTPHFEKAKIAAFTISAMVPCMKLYAFLGKGAQFLVDVNNNRHPYKKWIDNYSSEAFQAAARQIEELLDKLSVDLTVEDLNVMQKLYNQAMKLEMEFFLSQPLNQPTVVPLLEWHNRNCKETKSMVLRFSLILI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G402050`
TK1151 ID	TkA05G402050
OH-1004 ID	LXL04_021530
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.800
Protein coverage (%)	TK1151 93.889 / OH-1004 27.614 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G402050

Location Chr05:100068976-100071317 (+)

Description Similar to TH2: Bifunctional TH2 protein, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g32470`	May be involved in the salvage of thiamine breakdown products.	Arabidopsis TH2 Encodes the Orphan Enzyme Thiamin Monophosphate Phosphatase.2016 · DOI: 10.1105/tpc.16.00600

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021530 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006772 thiamine metabolic process Biological Process

GO:0009228 thiamine biosynthetic process Biological Process

GO:0009229 thiamine diphosphate biosynthetic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0004789 thiamine-phosphate diphosphorylase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0008902 hydroxymethylpyrimidine kinase activity Molecular Function

GO:0008972 phosphomethylpyrimidine kinase activity Molecular Function

GO:0042131 thiamine phosphate phosphatase activity Molecular Function

KEGG gene cross-reference

ath:AT5G32470

cef:CE1591

cgb:cg1654

cgl:Cgl1463

hin:HI_0358

spo:2541373

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.411

Rank 1 · TkA05G402050 · TK1151

Plastid0.190

Rank 2 · TkA05G402050 · TK1151

Nucleus0.166

Rank 3 · TkA05G402050 · TK1151

Peroxisome0.149

Rank 4 · TkA05G402050 · TK1151

Mitochondrion0.131

Rank 5 · TkA05G402050 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22651OBP47_like27-83 aa

PF01390SEA37-60 aa

PF03070TENA_THI-455-144 aa

PF01390SEA89-117 aa

PF11338DUF3140100-134 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G402050	`PF22651`	OBP47_like	27	83	0.076	13.4
TkA05G402050	`PF01390`	SEA	37	60	0.02	15.7
TkA05G402050	`PF03070`	TENA_THI-4	55	144	1.4e-09	38.7
TkA05G402050	`PF01390`	SEA	89	117	0.02	15.7
TkA05G402050	`PF11338`	DUF3140	100	134	0.24	12.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4KFT7`	Arabidopsis thaliana	sp\|F4KFT7\|TENAC_ARATH Bifunctional TH2 protein, mitochondrial	59.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card