Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1800 bp · TkA05G399360|TK1151|cDNA
CTGAAATATCCAAAGAATATGAAAACCGAATATTATCCGGATCAAATCACAGAGTCAGCGCAAATCGTCTTCCGGCTACAGTTGCCTACTTCCTTTCGTTTCTTGATCAACTGTCTATACATTTATAATACTAATATTACTACTTCTCGGAAAATCCAACTTCTCACAGAACGTGCTACATTTCCCAAAGGAGGGGAGGAGGAATTAAGAAATGGTCGGTGGGAAATGGTGGTGCTTCGGTGATCGTAGCTCCGACGACA...
1338 bp · TkA05G399360|TK1151|CDS
ATGGTCGGTGGGAAATGGTGGTGCTTCGGTGATCGTAGCTCCGACGACAATGTCTCTGATCTTGACCCGATACTTCTGGTGAGCGGCGTCGGTGGTACTATTCTGAATTCGAAGCCAAAAGGCTGGTTCGGGCTCACGACCCGTGTTTGGGTCCGAATCCTTCTTGCTGATTTGGAGTTCCGAAAGAGAGCCTGGTCCCTGTATAATCCCGAGACTGGCTACACAGAAGCGTTGGATGATAGTTGTGATATTGTGGTTCC...
Protein
Download Protein FASTA445 aa · TkA05G399360|TK1151|PROTEIN
MVGGKWWCFGDRSSDDNVSDLDPILLVSGVGGTILNSKPKGWFGLTTRVWVRILLADLEFRKRAWSLYNPETGYTEALDDSCDIVVPQDDYGLYAIDILDPSVLVKLLHVTDLYHFHDMIDMLVKCGYKKGTTLFGYGYDFRQSNRIDQSMDDLKEKLETAYKASGGKKVNLISHSMGGLLVSCFISLHSDVFSKYVKKWITIATPFQGAPGYINDTLLTGLQFVDGIESYFFVSRWSMHQLLIECPSIYEMLPNPEFKW...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA05G399360 |
|---|---|
| TK1151 ID | TkA05G399360 |
| OH-1004 ID | LXL04_021491 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA05G399360 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr05:99328364-99331394 (+) | |||||||||
| Description | Similar to LCAT3: Phospholipase A(1) LCAT3 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006071 glycerol metabolic process Biological Process GO:0006629 lipid metabolic process Biological Process GO:0006631 fatty acid metabolic process Biological Process GO:0006650 glycerophospholipid metabolic process Biological Process GO:0006651 diacylglycerol biosynthetic process Biological Process GO:0006658 phosphatidylserine metabolic process Biological Process GO:0006672 ceramide metabolic process Biological Process GO:0009395 phospholipid catabolic process Biological Process GO:0016042 lipid catabolic process Biological Process GO:0034638 phosphatidylcholine catabolic process Biological Process GO:0046338 phosphatidylethanolamine catabolic process Biological Process GO:0046470 phosphatidylcholine metabolic process Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT1G27480 ath:AT3G03310 ath:AT3G44830 ath:AT4G19860 bta:282271 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF12697Abhydrolase_650-54 aaPF02450LCAT68-390 aaPF01674Lipase_2115-181 aaPF05990DUF900132-183 aaPF00561Abhydrolase_1134-205 aaPF12697Abhydrolase_6136-241 aaPF12146Hydrolase_4144-213 aaPF02089Palm_thioest148-213 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA05G399360 | PF12697 | Abhydrolase_6 | 50 | 54 | 0.024 | 16.0 |
| TkA05G399360 | PF02450 | LCAT | 68 | 390 | 2.1e-28 | 100.4 |
| TkA05G399360 | PF01674 | Lipase_2 | 115 | 181 | 0.033 | 14.4 |
| TkA05G399360 | PF05990 | DUF900 | 132 | 183 | 0.00015 | 22.0 |
| TkA05G399360 | PF00561 | Abhydrolase_1 | 134 | 205 | 9.2e-07 | 29.5 |
| TkA05G399360 | PF12697 | Abhydrolase_6 | 136 | 241 | 0.024 | 16.0 |
| TkA05G399360 | PF12146 | Hydrolase_4 | 144 | 213 | 1.1e-05 | 25.6 |
| TkA05G399360 | PF02089 | Palm_thioest | 148 | 213 | 0.088 | 13.2 |
| TkA05G399360 | PF06028 | DUF915 | 156 | 210 | 8.5e-05 | 22.7 |
| TkA05G399360 | PF05057 | DUF676 | 158 | 230 | 3e-05 | 24.4 |
| TkA05G399360 | PF07819 | PGAP1 | 163 | 218 | 2e-05 | 25.2 |
| TkA05G399360 | PF14436 | EndoU_bacteria | 229 | 276 | 0.28 | 12.2 |
| TkA05G399360 | PF06028 | DUF915 | 332 | 346 | 8.5e-05 | 22.7 |
| TkA05G399360 | PF12697 | Abhydrolase_6 | 380 | 410 | 0.024 | 16.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.