TkA05G398130 | RubberDandelionOmics

Gene overview

TkA05G398130

Reference: TK1151 Chr: Chr05 Coordinates: 98974528-98978989 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4322 bp · TkA05G398130|TK1151|cDNA

TTTTGGAACAACCTAATCTATTCCGTGAACTCTCGGTATCATTTAGGCATGACACATATTAACCAAAGTCCAAAGGTCTTTTGGTAGGAGATGACCCTTTTTATTTTAGCAAGCAATGAACATTTCCATTTGGACCATTTCTGCATTCTCTTCTTTATGGTTTCTTCCTCTTACGTAATACACAGGCCCAATTAGCTGACATCGAACAGGCTGAAGCCCATAACGTGAGAGTAAATCAAGTAATCAGCTGAACTGAACTT...

CDS

Download CDS FASTA

951 bp · TkA05G398130|TK1151|CDS

ATGGCCCTCGTTCGTGAACGACGTCAGCCAAAACTCGGCCTCCGATTACCGGAGATCTCCGATCGCCGCCCTCGTTTCCCCCTACCCCTCCCCCCCACCACCCTTCAACAATCGGCAACCACCCCCTCATCCACCACCGCCGCCGAACTGGAGACCCTTCAAGTCCTGGGTCACGGCAACGGCGGTACCGTCTACAAAGTAGTACATAAGAAAACGTCTAACGTTTACGCGCTCAAGGTTGTACATGCCGACAGTGATCC...

Protein

Download Protein FASTA

316 aa · TkA05G398130|TK1151|PROTEIN

MALVRERRQPKLGLRLPEISDRRPRFPLPLPPTTLQQSATTPSSTTAAELETLQVLGHGNGGTVYKVVHKKTSNVYALKVVHADSDPMMRRQIFREMEILRRTDSPFVVHCHEIFEKPDGDIAILMEYMDAGTLDSLLKTGGTFTEKSLADIARQILNGLNYLHAHKIIHRDIKPANLLVNKNMEVKIADFGVSKIMCRTLDACNSYVGTCAYMSPERFDPDTHGANYNGYSGDIWSLGLTMLELYMGHFPLLPAGQKPD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G398130`
TK1151 ID	TkA05G398130
OH-1004 ID	LXL04_021464
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G398130

Location Chr05:98974528-98978989 (+)

Description Similar to MKK9: Mitogen-activated protein kinase kinase 9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g73500`	MKK9-MPK3/MPK6 module phosphorylates and activates EIN3, leading to the promotion of EIN3-mediated transcription in ethylene signaling.	Dual control of nuclear EIN3 by bifurcate MAPK cascades in C2H4 signalling.2008 · DOI: 10.1038/nature06543 Activation of MAPK kinase 9 induces ethylene and camalexin biosynthesis and enhances sensitivity to salt stress in Arabidopsis.2008 · DOI: 10.1074/jbc.m801392200 An arabidopsis mitogen-activated protein kinase cascade, MKK9-MPK6, plays a role in leaf senescence.2009 · DOI: 10.1104/pp.108.133439
`At1g18350`	May function as a negative regulator of polar auxin transport.	Increased expression of MAP KINASE KINASE7 causes deficiency in polar auxin transport and leads to plant architectural abnormality in Arabidopsis.2006 · DOI: 10.1105/tpc.105.037846 Overexpression of Arabidopsis MAP kinase kinase 7 leads to activation of plant basal and systemic acquired resistance.2007 · DOI: 10.1111/j.1365-313x.2007.03294.x
`At3g06230`	Mitogen-activated protein kinase kinase 8.	No verified direct reference in this release
`At3g21220`	Mitogen-activated protein kinase kinase (MAPKK) which regulates abscisic acid (ABA) responses in a MAPKKK20-MKK5-MPK6 cascade involved in root growth (e.g. root cell division and elongation) and stomatal response, probably via MAPK6 activation by protein phosphorylation.	Cell death mediated by MAPK is associated with hydrogen peroxide production in Arabidopsis.2002 · DOI: 10.1074/jbc.m109495200 MAP kinase signalling cascade in Arabidopsis innate immunity.2002 · DOI: 10.1038/415977a Stomatal development and patterning are regulated by environmentally responsive mitogen-activated protein kinases in Arabidopsis.2007 · DOI: 10.1105/tpc.106.048298 Ethylene signaling is required for the acceleration of cell death induced by the activation of AtMEK5 in Arabidopsis.2008 · DOI: 10.1038/cr.2008.29 Regulation of floral organ abscission in Arabidopsis thaliana.2008 · DOI: 10.1073/pnas.0805539105 A Pseudomonas syringae ADP-ribosyltransferase inhibits Arabidopsis mitogen-activated protein kinase kinases.2010 · DOI: 10.1105/tpc.110.075697 A MAPK cascade downstream of ERECTA receptor-like protein kinase regulates Arabidopsis inflorescence architecture by promoting localized cell proliferation.2012 · DOI: 10.1105/tpc.112.104695 Brassinosteroid-regulated GSK3/Shaggy-like kinases phosphorylate mitogen-activated protein (MAP) kinase kinases, which control stomata development in Arabidopsis thaliana.2013 · DOI: 10.1074/jbc.m112.384453 MKK5 regulates high light-induced gene expression of Cu/Zn superoxide dismutase 1 and 2 in Arabidopsis.2013 · DOI: 10.1093/pcp/pct072 Identification of BZR1-interacting proteins as potential components of the brassinosteroid signaling pathway in Arabidopsis through tandem affinity purification.2013 · DOI: 10.1074/mcp.m113.029256 AIK1, A Mitogen-Activated Protein Kinase, Modulates Abscisic Acid Responses through the MKK5-MPK6 Kinase Cascade.2017 · DOI: 10.1104/pp.16.01386
`At1g51660`	Involved in the second phase of hydrogen peroxide generation during hypersensitive response-like cell death.	MAP kinase signalling cascade in Arabidopsis innate immunity.2002 · DOI: 10.1038/415977a Stomatal development and patterning are regulated by environmentally responsive mitogen-activated protein kinases in Arabidopsis.2007 · DOI: 10.1105/tpc.106.048298 Regulation of floral organ abscission in Arabidopsis thaliana.2008 · DOI: 10.1073/pnas.0805539105 Arabidopsis MKK4 mediates osmotic-stress response via its regulation of MPK3 activity.2011 · DOI: 10.1016/j.bbrc.2011.07.064 A MAPK cascade downstream of ERECTA receptor-like protein kinase regulates Arabidopsis inflorescence architecture by promoting localized cell proliferation.2012 · DOI: 10.1105/tpc.112.104695 Brassinosteroid-regulated GSK3/Shaggy-like kinases phosphorylate mitogen-activated protein (MAP) kinase kinases, which control stomata development in Arabidopsis thaliana.2013 · DOI: 10.1074/jbc.m112.384453

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021464 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000165 MAPK cascade Biological Process

GO:0002229 defense response to oomycetes Biological Process

GO:0007165 signal transduction Biological Process

GO:0009611 response to wounding Biological Process

GO:0009620 response to fungus Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009693 ethylene biosynthetic process Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009862 systemic acquired resistance, salicylic acid mediated signaling pathway Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0009875 pollen-pistil interaction Biological Process

KEGG gene cross-reference

ath:AT1G18350

ath:AT1G51660

ath:AT1G73500

ath:AT3G06230

ath:AT3G21220

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.599

Rank 1 · TkA05G398130 · TK1151

Nucleus0.540

Rank 2 · TkA05G398130 · TK1151

Cell membrane0.074

Rank 3 · TkA05G398130 · TK1151

Endoplasmic reticulum0.054

Rank 4 · TkA05G398130 · TK1151

Mitochondrion0.050

Rank 5 · TkA05G398130 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30117MSD537-53 aa

PF13095FTA247-82 aa

PF10707YrbL-PhoP_reg50-98 aa

PF00069Pkinase51-310 aa

PF07714PK_Tyr_Ser-Thr51-305 aa

PF01636APH53-165 aa

PF17667Pkinase_fungal59-105 aa

PF01163RIO161-192 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G398130	`PF30117`	MSD5	37	53	0.25	12.3
TkA05G398130	`PF13095`	FTA2	47	82	0.00066	20.1
TkA05G398130	`PF10707`	YrbL-PhoP_reg	50	98	0.036	14.4
TkA05G398130	`PF00069`	Pkinase	51	310	4.9e-68	230.1
TkA05G398130	`PF07714`	PK_Tyr_Ser-Thr	51	305	1.1e-38	133.7
TkA05G398130	`PF01636`	APH	53	165	0.00041	20.9
TkA05G398130	`PF17667`	Pkinase_fungal	59	105	0.0026	17.3
TkA05G398130	`PF01163`	RIO1	61	192	0.0008	19.8
TkA05G398130	`PF03109`	ABC1	62	89	9.6e-06	25.6
TkA05G398130	`PF03109`	ABC1	123	195	9.6e-06	25.6
TkA05G398130	`PF06293`	Kdo	123	185	0.32	11.1
TkA05G398130	`PF14531`	Kinase-like	130	249	0.00032	20.8
TkA05G398130	`PF30117`	MSD5	146	198	0.25	12.3
TkA05G398130	`PF10707`	YrbL-PhoP_reg	147	187	0.036	14.4
TkA05G398130	`PF13095`	FTA2	151	182	0.00066	20.1
TkA05G398130	`PF17667`	Pkinase_fungal	154	224	0.0026	17.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FX43`	Arabidopsis thaliana	sp\|Q9FX43\|M2K9_ARATH Mitogen-activated protein kinase kinase 9	66.500%	Swiss-Prot	High
`Q9LPQ3`	Arabidopsis thaliana	sp\|Q9LPQ3\|M2K7_ARATH Mitogen-activated protein kinase kinase 7	60.900%	Swiss-Prot	High
`Q9M8J5`	Arabidopsis thaliana	sp\|Q9M8J5\|M2K8_ARATH Mitogen-activated protein kinase kinase 8	53.400%	Swiss-Prot	High
`Q8RXG3`	Arabidopsis thaliana	sp\|Q8RXG3\|M2K5_ARATH Mitogen-activated protein kinase kinase 5	53.200%	Swiss-Prot	High
`O80397`	Arabidopsis thaliana	sp\|O80397\|M2K4_ARATH Mitogen-activated protein kinase kinase 4	48.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card