TkA05G381500 | RubberDandelionOmics

Gene overview

TkA05G381500

Reference: TK1151 Chr: Chr05 Coordinates: 94751083-94754657 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1457 bp · TkA05G381500|TK1151|cDNA

TGGAATACGATTTTAGGTCACAATTTCTCAGGAGATTTCCTAAACGCAACATGATGCTTTTGGACAAAGTAAAGGTCGCTACTTTCCGGTTAAAGATCGAAGAGAAGTAAGAGCAATGACACTACACATCCATATTTACTAATTCCTTTCACCACGCCCCTCCAAACACGGCCACAAGATTTCCTCATTCCCCTCTTCTTCTTCAACATAAAGTGTCAAATACGTCCCCTTATGCTCCTTTTGCTCTTCCGCAAGAACGA...

CDS

Download CDS FASTA

765 bp · TkA05G381500|TK1151|CDS

ATGACGGTCGGGCGGCCACGGAACGGTAGGGATATCATCTACGATGCCGTTTCTGGTGCCTCTGCAGGTGCAATAGCTGCCACTCTTATGAGCCCATTAGATGTGATTAAGACACGACTGCAAGTTTATGGCCTCCCTGATGTCCCCAGAAGTAAAGGTAGTGTTATTGTGACAAGCTTCCAAAACATTATAAAAAATGAGGGATTGAGGGGATTATATAGAGGACTTTCTCCAACATTGGCTGCATTACTTCCAAATTG...

Protein

Download Protein FASTA

254 aa · TkA05G381500|TK1151|PROTEIN

MTVGRPRNGRDIIYDAVSGASAGAIAATLMSPLDVIKTRLQVYGLPDVPRSKGSVIVTSFQNIIKNEGLRGLYRGLSPTLAALLPNWAVYFAVYGQLKELLDSHGDGMGHLTFGANMIAASGAGAATAITTNPLWVVKTRLQTQGMRVGVVPYTSISSALRRIVHEEGFRGLYSGLLPSLAGISHVAIQFPAYEKIKLYLADRDHTTTNNLSPGKLAIASSMSKVLASLMTYPHEVIRSRLQESVSERGSGGVL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G381500`
TK1151 ID	TkA05G381500
OH-1004 ID	LXL04_024997
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	80.200
Protein coverage (%)	TK1151 98.819 / OH-1004 57.403 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G381500

Location Chr05:94751083-94754657 (-)

Description Similar to NDT2: Nicotinamide adenine dinucleotide transporter 2, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g25380`	May mediate NAD⁺ import into chloroplasts.	Molecular identification and functional characterization of Arabidopsis thaliana mitochondrial and chloroplastic NAD+ carrier proteins.2009 · DOI: 10.1074/jbc.m109.041830
`At2g47490`	May mediate NAD⁺ import into chloroplasts.	Molecular identification and functional characterization of Arabidopsis thaliana mitochondrial and chloroplastic NAD+ carrier proteins.2009 · DOI: 10.1074/jbc.m109.041830

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024997 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0035352 NAD transmembrane transport Biological Process

GO:0043132 NAD transport Biological Process

GO:1990549 mitochondrial NAD transmembrane transport Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0031966 mitochondrial membrane Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0015297 antiporter activity Molecular Function

GO:0051724 NAD transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G25380

ath:AT2G47490

ddi:DDB_G0290669

sce:YEL006W

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.866

Rank 1 · TkA05G381500 · TK1151

Cytoplasm0.037

Rank 2 · TkA05G381500 · TK1151

Peroxisome0.026

Rank 3 · TkA05G381500 · TK1151

Nucleus0.024

Rank 4 · TkA05G381500 · TK1151

Plastid0.023

Rank 5 · TkA05G381500 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00153Mito_carr12-102 aa

PF01734Patatin12-30 aa

PF18405SLC25_like14-35 aa

PF18405SLC25_like68-81 aa

PF00153Mito_carr110-202 aa

PF01734Patatin117-129 aa

PF18405SLC25_like156-197 aa

PF00153Mito_carr211-247 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G381500	`PF00153`	Mito_carr	12	102	9.3e-58	192.7
TkA05G381500	`PF01734`	Patatin	12	30	0.12	13.3
TkA05G381500	`PF18405`	SLC25_like	14	35	0.25	11.1
TkA05G381500	`PF18405`	SLC25_like	68	81	0.25	11.1
TkA05G381500	`PF00153`	Mito_carr	110	202	9.3e-58	192.7
TkA05G381500	`PF01734`	Patatin	117	129	0.12	13.3
TkA05G381500	`PF18405`	SLC25_like	156	197	0.25	11.1
TkA05G381500	`PF00153`	Mito_carr	211	247	9.3e-58	192.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RWA5`	Arabidopsis thaliana	sp\|Q8RWA5\|NDT2_ARATH Nicotinamide adenine dinucleotide transporter 2, mitochondrial	68.600%	Swiss-Prot	High
`O22261`	Arabidopsis thaliana	sp\|O22261\|NDT1_ARATH Nicotinamide adenine dinucleotide transporter 1, chloroplastic	61.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card