LXL04_024997 | RubberDandelionOmics

Gene overview

LXL04_024997

Reference: OH-1004 Chr: Chr05 Coordinates: 103769216-103771742 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1320 bp · LXL04_024997|LXL04_024997|OH1004|cDNA

ATGACGGGTGGGGAGCATCGGAATGGTAAAGACATCATCTGCGACGCCGTATCTGGTGCCTCCGCAGGTGCTATTGCTGCCACTTTCGTGTGTCCATTAGATGTGATCAAGACAAGACTCCAAGTTCACGGCCTGCCCAATGTACCTCTAGGGCACAAAGGTGGTGTCATTGTCACAAGCCTAGAAAACATTATAAAAAAAGACGGATTAAGAGGCCTTTACAGAGGCCTTTCACCAACATTAGCCGCTCTACTTCCCAA...

CDS

Download CDS FASTA

1320 bp · LXL04_024997|LXL04_024997|OH1004|CDS

ATGACGGGTGGGGAGCATCGGAATGGTAAAGACATCATCTGCGACGCCGTATCTGGTGCCTCCGCAGGTGCTATTGCTGCCACTTTCGTGTGTCCATTAGATGTGATCAAGACAAGACTCCAAGTTCACGGCCTGCCCAATGTACCTCTAGGGCACAAAGGTGGTGTCATTGTCACAAGCCTAGAAAACATTATAAAAAAAGACGGATTAAGAGGCCTTTACAGAGGCCTTTCACCAACATTAGCCGCTCTACTTCCCAA...

Protein

Download Protein FASTA

439 aa · LXL04_024997|LXL04_024997|OH1004|PROTEIN

MTGGEHRNGKDIICDAVSGASAGAIAATFVCPLDVIKTRLQVHGLPNVPLGHKGGVIVTSLENIIKKDGLRGLYRGLSPTLAALLPNWAVYFAVYGHLKELLHSHADNNGHLSFGANMIAASGAGAATSFATNPLWVVKTRLQTQGLRVGVVPYTGILSALRRIMREEGFRGWYSGLLPSLAGISHVAIQFPAYEKFKCYLAQRDNTSIKELSPGKVAVASSMSKVLASLITYPHEVIRSRLQEQGQVRNTGNHYKGVVD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024997`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024997

Location Chr05:103769216-103771742 (+)

Description Similar to NDT2: Nicotinamide adenine dinucleotide transporter 2, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g25380`	May mediate NAD⁺ import into chloroplasts.	Molecular identification and functional characterization of Arabidopsis thaliana mitochondrial and chloroplastic NAD+ carrier proteins.2009 · DOI: 10.1074/jbc.m109.041830
`At2g47490`	May mediate NAD⁺ import into chloroplasts.	Molecular identification and functional characterization of Arabidopsis thaliana mitochondrial and chloroplastic NAD+ carrier proteins.2009 · DOI: 10.1074/jbc.m109.041830

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024997 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0035352 NAD transmembrane transport Biological Process

GO:0043132 NAD transport Biological Process

GO:1990549 mitochondrial NAD transmembrane transport Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0031966 mitochondrial membrane Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0015297 antiporter activity Molecular Function

GO:0051724 NAD transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G25380

ath:AT2G47490

ddi:DDB_G0290669

sce:YEL006W

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.830

Rank 1 · LXL04_024997 · OH-1004

Cytoplasm0.059

Rank 2 · LXL04_024997 · OH-1004

Peroxisome0.054

Rank 3 · LXL04_024997 · OH-1004

Plastid0.040

Rank 4 · LXL04_024997 · OH-1004

Nucleus0.032

Rank 5 · LXL04_024997 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00153.33Mito_carr12-105 aa

PF00153.33Mito_carr111-203 aa

PF00153.33Mito_carr211-306 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024997	`PF00153.33`	Mito_carr	12	105	1.1e-75	250.2
LXL04_024997	`PF00153.33`	Mito_carr	111	203	1.1e-75	250.2
LXL04_024997	`PF00153.33`	Mito_carr	211	306	1.1e-75	250.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RWA5`	Arabidopsis thaliana	Nicotinamide adenine dinucleotide transporter 2, mitochondrial	68.106%	Swiss-Prot	moderate database homology
`O22261`	Arabidopsis thaliana	Nicotinamide adenine dinucleotide transporter 1, chloroplastic	63.279%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card